Overview

  • Product name

  • Description

    Rabbit polyclonal to ZDHHC9
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide within Human ZDHHC9 aa 120-150 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    QRPPPRIKNFQINNQIVKLKYCYTCKIFRPP


    Database link: Q9Y397

  • Positive control

    • Rat kidney lysate. Human lung carcinoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab217757 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Detects a band of approximately 40 kDa (predicted molecular weight: 41 kDa).
IHC-P 1/100 - 1/500.

Target

  • Function

    The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.
  • Tissue specificity

    Highly expressed in kidney, skeletal muscle, brain, lung and liver. Absent in thymus, spleen and leukocytes.
  • Involvement in disease

    Defects in ZDHHC9 are the cause of mental retardation syndromic X-linked ZDHHC9-related (MRXSZ) [MIM:300799]. A disorder characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Some patients have marfanoid habitus as an additional feature.
  • Sequence similarities

    Belongs to the DHHC palmitoyltransferase family. ERF2/ZDHHC9 subfamily.
    Contains 1 DHHC-type zinc finger.
  • Domain

    The DHHC domain is required for palmitoyltransferase activity.
  • Cellular localization

    Endoplasmic reticulum membrane. Golgi apparatus membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Antigen MMSA 1 antibody
    • Asp His His Cys domain containing protein 9 antibody
    • CGI89 antibody
    • CXorf11 antibody
    • DHHC-9 antibody
    • DHHC9 antibody
    • MMSA1 antibody
    • MRXSZ antibody
    • Palmitoyltransferase ZDHHC9 antibody
    • ZDHC9_HUMAN antibody
    • ZDHHC 9 antibody
    • ZDHHC10 antibody
    • ZDHHC9 antibody
    • Zinc finger DHHC domain containing 10 antibody
    • Zinc finger DHHC domain containing protein 9 antibody
    • Zinc finger DHHC domain-containing protein 9 antibody
    • Zinc finger DHHC type containing 9 antibody
    • Zinc finger protein 379 antibody
    • Zinc finger protein 380 antibody
    • ZNF379 antibody
    • ZNF380 antibody
    see all

Images

  • All lanes : Anti-ZDHHC9 antibody (ab217757) at 1/200 dilution

    Lane 1 : Rat kidney lysate
    Lane 2 : Rat brain lysate

    Secondary
    All lanes : Goat anti-rabbit IgG (H+L), HRP conjugated at 1/3000 dilution

    Predicted band size: 41 kDa
    Observed band size: 40 kDa
    why is the actual band size different from the predicted?



    12% SDS-PAGE gel.

References

ab217757 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217757.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up