Overview

  • Product name

  • Description

    Rabbit Polyclonal to ZEB2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Smad Interacting Protein 1 aa 731-854.
    Sequence:

    SPVKPMDSITSPSIAELHNSVTNCDPPLRLTKPSHFTNIKPVEKLDHSRS NTPSPLNLSSTSSKNSHSSSYTPNSFSSEELQAEPLDLSLPKQMKEPKSI IATKNKTKASSISLDHNSVSSSSE


    Database link: O60315

  • Positive control

    • IHC-P: Human cerebral cortex, glioma and colon tissues. WB: HEL cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab223688 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 136 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Transcriptional inhibitor that binds to DNA sequence 5'-CACCT-3' in different promoters. Represses transcription of E-cadherin.
  • Involvement in disease

    Defects in ZEB2 are the cause of Mowat-Wilson syndrome (MWIS) [MIM:235730]; also known as Hirschsprung disease-mental retardation syndrome. A complex developmental disorder characterized by mental retardation, delayed motor development, epilepsy, microcephaly and a wide spectrum of clinically heterogeneous features suggestive of neurocristopathies at the cephalic, cardiac, and vagal levels. Some patients manifest Hirschsprung disease. Affected patients show an easily recognizable facial appearance with deep set eyes and hypertelorism, medially divergent, broad eyebrows, prominent columella, pointed chin and uplifted, notched ear lobes.
  • Sequence similarities

    Belongs to the delta-EF1/ZFH-1 C2H2-type zinc-finger family.
    Contains 7 C2H2-type zinc fingers.
    Contains 1 homeobox DNA-binding domain.
  • Post-translational
    modifications

    Sumoylation on Lys-391 and Lys-866 is promoted by the E3 SUMO-protein ligase CBX4, and impairs interaction with CTBP1 and transcription repression activity.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ42816 antibody
    • HSPC082 antibody
    • KIAA0569 antibody
    • SIP 1 antibody
    • SIP1 antibody
    • Smad Interacting Protein 1 antibody
    • Smad-interacting protein 1 antibody
    • SMADIP 1 antibody
    • SMADIP1 antibody
    • ZEB 2 antibody
    • Zeb2 antibody
    • ZEB2_HUMAN antibody
    • Zfhx1b antibody
    • ZFHX1B protein antibody
    • Zfx1b antibody
    • Zinc finger E box binding protein 2 antibody
    • Zinc finger E-box-binding homeobox 2 antibody
    • Zinc finger homeobox 1b antibody
    • zinc finger homeobox protein 1 antibody
    • Zinc finger homeobox protein 1b antibody
    see all

Images

  • Paraffin-embedded human cerebral cortex tissue stained for Smad Interacting Protein 1 using ab223688 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human glioma tissue stained for Smad Interacting Protein 1 using ab223688 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colon tissue stained for Smad Interacting Protein 1 using ab223688 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreas tissue stained for Smad Interacting Protein 1 using ab223688 at 1/200 dilution in immunohistochemical analysis. Negative control - no staining.

  • Anti-ZEB2 antibody (ab223688) at 1/100 dilution + HEL (human bone marrow erythroleukemia cell line) cell lysate

    Predicted band size: 136 kDa

References

ab223688 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223688.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up