Overview

  • Product name

    Anti-ZFP100 / ZNF473 antibody
  • Description

    Rabbit polyclonal to ZFP100 / ZNF473
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ZFP100/ ZNF473 aa 68-197.
    Sequence:

    GSPEATSPDVTETKNSPLMEDFFEEGFSQEIIEMLSKDGFWNSNFGEACI EDTWLDSLLGDPESLLRSDIATNGESPTECKSHELKRGLSPVSTVSTGED SMVHNVSEKTLTPAKSKEYRGEFFSYSDHS


    Database link: Q8WTR7

  • Positive control

    • IHC-P: Human vulva/anal skin.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224230 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Involved in histone 3'-end pre-mRNA processing by associating with U7 snRNP and interacting with SLBP/pre-mRNA complex. Increases histone 3'-end pre-mRNA processing but has no effect on U7 snRNP levels, when overexpressed. Required for cell cycle progression from G1 to S phases.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 20 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Domain

    The C2H2-type zinc finger 2 to 6 are necessary and sufficient for discrete Cajal bodies localization. The C2H2-type zinc finger 5 to 10 are necessary and sufficient for interaction with LSM11. The C2H2-type zinc finger 2 to 8 are necessary for interaction with the SLBP/RNA complex in the histone pre-mRNAs. The C2H2-type zinc finger 2 to 10 confer activity in histone pre-mRNA processing.
  • Cellular localization

    Nucleus. Stable component of Cajal bodies (CBs). Colocalizes with SMN, coilin and U7 snRNA.
  • Information by UniProt
  • Database links

  • Alternative names

    • HZFP100 antibody
    • Zfp 100 antibody
    • Zfp-100 antibody
    • Zinc finger protein 100 homolog antibody
    • Zinc finger protein 473 antibody
    • zinc finger protein ZFP100 antibody
    • ZN473_HUMAN antibody
    • Znf473 antibody
    see all

Images

  • Paraffin-embedded human vulva/anal skin stained for ZFP100 / ZNF473 with ab224230 (1/50) in immunohistochemical analysis.

References

ab224230 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224230.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up