Overview

  • Product name
    Anti-ZFP296 antibody
  • Description
    Rabbit polyclonal to ZFP296
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human ZFP296 aa 421-470 (C terminal). The exact sequence is proprietary.
    Sequence:

    YACAQSSKLNRHRRMHGMTPGSTRFECPHCHVPFGLRATLDKHLRQKHPE


    Database link: Q8WUU4

  • Positive control
    • Jurkat cell lysate, Human kidney and stomach tissues.
  • General notes

    Previously labelled as ZNF342. 

Properties

Applications

Our Abpromise guarantee covers the use of ab51265 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.125 µg/ml. Detects a band of approximately 50 kDa (predicted molecular weight: 50 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 4 - 8 µg/ml.

Target

  • Function
    May be involved in transcriptional regulation.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 6 C2H2-type zinc fingers.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • ZFP296 antibody
    • Zinc finger protein 296 antibody
    • Zinc finger protein 342 antibody
    • ZN296_HUMAN antibody
    • ZNF296 antibody
    • ZNF342 antibody
    see all

Images

  • Lane 1 : Molecular weight markers
    Lane 2 : Anti-ZFP296 antibody (ab51265) at 0.125 µg/ml

    Lane 2 : Jurkat cell lysate at 10 µg

    Secondary
    Lane 2 : HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 50 kDa
    Observed band size: 50 kDa

  • Ab51265 at 8 µg/ml staining epithelial cells of renal tubules from paraffin embedded human kidney.
  • Ab51265 at 8 µg/ml staining epithelial cells of fundic gland from paraffin embedded human stomach.

References

This product has been referenced in:
  • Levin VA  et al. Different changes in protein and phosphoprotein levels result from serum starvation of high-grade glioma and adenocarcinoma cell lines. J Proteome Res 9:179-91 (2010). WB ; Human . Read more (PubMed: 19894763) »
  • Poland KS  et al. Overexpression of ZNF342 by juxtaposition with MPO promoter/enhancer in the novel translocation t(17;19)(q23;q13.32) in pediatric acute myeloid leukemia and analysis of ZNF342 expression in leukemia. Genes Chromosomes Cancer 48:480-9 (2009). Read more (PubMed: 19255975) »
See all 2 Publications for this product

Customer reviews and Q&As

Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Western blot
Sample
Human Cell lysate - nuclear (Multiple cell types)
Loading amount
30 µg
Specification
Multiple cell types
Gel Running Conditions
Reduced Denaturing (10% gel)
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Dr. Seth Frietze

Verified customer

Submitted Jun 30 2011

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up