Overview

  • Product name

  • Description

    Rabbit polyclonal to ZFP36L1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Dog
  • Immunogen

    Synthetic peptide corresponding to Human ZFP36L1 aa 66-115.
    Sequence:

    QLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGGQVNSSRY


    Database link: Q07352

  • Positive control

    • Human placenta lysate.
  • General notes

     This product was previously labelled as TIS11B

     

Properties

Applications

Our Abpromise guarantee covers the use of ab35801 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 µg/ml. Predicted molecular weight: 38 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA 1/62500.

Target

Images

  • Anti-ZFP36L1 antibody (ab35801) at 0.5 µg/ml (in 5% skim milk / PBS buffer) + Human placental lysate at 10 µg

    Secondary
    HRP-conjugated anti-Rabbit IgG

    Predicted band size: 38 kDa
    Observed band size: 45 kDa
    why is the actual band size different from the predicted?

References

This product has been referenced in:

  • Vignudelli T  et al. ZFP36L1 negatively regulates erythroid differentiation of CD34+ hematopoietic stem cells by interfering with the Stat5b pathway. Mol Biol Cell 21:3340-51 (2010). Read more (PubMed: 20702587) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab35801.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up