Overview

  • Product name

    Anti-ZFP38 antibody
  • Description

    Rabbit polyclonal to ZFP38
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse, Chimpanzee, Gorilla
  • Immunogen

    Recombinant fragment corresponding to Human ZFP38 aa 253-401.
    Sequence:

    PLQEAGSKKGRESVPTKPTPGERRYICAECGKAFSNSSNLTKHRRTHTGE KPYVCTKCGKAFSHSSNLTLHYRTHLVDRPYDCKCGKAFGQSSDLLKHQR MHTEEAPYQCKDCGKAFSGKGSLIRHYRIHTGEKPYQCNECGKSFSQHA


    Database link: Q9Y5A6

  • Positive control

    • IHC-P: Human kidney tissue. WB: RT4 and NBT-II cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab224449 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 54 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Paraffin-embedded human kidney tissue stained for ZFP38 using ab224449 at 1/50 dilution in immunohistochemical analysis.

  • Anti-ZFP38 antibody (ab224449) at 1/100 dilution + RT4 (human urinary bladder cancer cell line) cell lysate

    Predicted band size: 54 kDa

  • All lanes : Anti-ZFP38 antibody (ab224449) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embyro fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate

    Predicted band size: 54 kDa

References

ab224449 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224449.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up