Overview

  • Product name

  • Description

    Rabbit polyclonal to ZFP69
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ZFP69 aa 132-205 (internal sequence).
    Sequence:

    EEPWMAEKEGPGDPSSDLKSKIETIESTAKSTISQERLYHGIMMESFMRD DIIYSTLRKVSTYDDVLERHQETC


    Database link: Q49AA0

  • Positive control

    • Human gall bladder tissue, RT-4 cell and U-251 MG cell lysates.
  • General notes

    Previously labelled as ZNF642.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab150824 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/500. Predicted molecular weight: 61 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use at an assay dependent concentration.

Target

  • Function

    May be involved in transcriptional regulation.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 9 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ16030 antibody
    • RP11 656D10.2 antibody
    • Zfp69 antibody
    • ZFP69 Zinc Finger Protein A antibody
    • ZFP69 Zinc Finger Protein antibody
    • ZFP69A antibody
    • Zinc finger protein 642 antibody
    • Zinc Finger Protein ZFP69 antibody
    • ZKSCAN23A antibody
    • ZN642_HUMAN antibody
    • ZNF642 antibody
    • ZSCAN54A antibody
    see all

Images

  • Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli.
  • Immunohistochemical analysis of paraffin-embedded Human gall bladder tissue, labelling ZFP69 with ab150824 at 1/200 dilution.

  • All lanes : Anti-ZFP69 antibody (ab150824) at 1/250 dilution

    Lane 1 : RT-$ cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate

    Developed using the ECL technique.

    Predicted band size: 61 kDa

References

ab150824 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab150824.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up