Overview

  • Product name

  • Description

    Rabbit polyclonal to ZFP91
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ZFP91 aa 135-195.
    Sequence:

    SALPQEVSIAASRPSRGWRSSRTSVSRHRDTENTRSSRSKTGSLQLICKS EPNTDQLDYDV


    Database link: Q96JP5

  • Positive control

    • U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221482 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
Recommended conditions:
Fixation/Permeabilization: PFA/Triton X-100

Target

  • Relevance

    The protein encoded by ZFP91 is a member of the zinc finger family of proteins. This protein contains C2H2 type domains, which are the classical zinc finger domains found in numerous nucleic acid-binding proteins.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • FKSG11 antibody
    • HGNC:14983 antibody
    • PZF antibody
    • zinc finger protein 91 antibody
    • zinc finger protein 91 homolog (mouse) antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed/Triton X-100 permeabilized U-2 OS cells labeling ZFP91 with ab221482 at 4 μg/ml (green).

References

ab221482 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221482.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up