Overview

  • Product name

    Anti-ZFR2 antibody
  • Description

    Rabbit polyclonal to ZFR2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ZFR2 aa 87-167.
    Sequence:

    YQDSYSYGQSAAARSYEDRPYFQSAALQSGRMTAADSGQPGTQEACGQPS PHGSHSHAQPPQQAPIVESGQPASTLSSGYT


    Database link: Q9UPR6

  • Positive control

    • RT-4 and U-251 cell lysates; Human rectum tissue; SiHa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204415 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

IHC-P 1/2500 - 1/5000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/500 - 1/1000. Predicted molecular weight: 101 kDa.

Target

Images

  • Immunohistochemical analysis of paraffin-embedded Human rectum tissue labeling ZFR2 with ab204415 at 1/2500 dilution.

  • All lanes : Anti-ZFR2 antibody (ab204415) at 1/500 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate

    Predicted band size: 101 kDa

  • Immunofluorescent analysis of  Human SiHa cells (PFA-fixed/Triton X-100 permeabilized) labeling ZFR2 with ab204415 at 4 µg/ml (green).

References

This product has been referenced in:

  • Li W  et al. MiR-141-3p functions as a tumor suppressor through directly targeting ZFR in non-small cell lung cancer. Biochem Biophys Res Commun 509:647-656 (2019). Read more (PubMed: 30611568) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204415.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up