Overview

  • Product name

  • Description

    Rabbit polyclonal to Zhangfei
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human Zhangfei aa 292-352.
    Sequence:

    TTSLFRDSPAGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVSVEFC SACARKASSSL


    Database link: Q9NS37

  • Positive control

    • HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab221095 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Strongly activates transcription when bound to HCFC1. Suppresses the expression of HSV proteins in cells infected with the virus in a HCFC1-dependent manner. Also suppresses the HCFC1-dependent transcriptional activation by CREB3 and reduces the amount of CREB3 in the cell. Able to down-regulate expression of some cellular genes in CREBZF-expressing cells.
  • Tissue specificity

    In adults, expressed most abundantly in heart, liver and skeletal muscle, moderately abundant in kidney and pancreas, and barely detectable in lung. In fetal tissues, expressed most abundantly in kidney and very low amounts in heart, lung and liver.
  • Sequence similarities

    Belongs to the bZIP family. ATF subfamily.
    Contains 1 bZIP domain.
  • Cellular localization

    Nucleus. Colocalizes at punctate nuclear structures with CREB3 and HCFC1.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1110034C16Rik antibody
    • 6330417B10Rik antibody
    • AI225749 antibody
    • AI606244 antibody
    • CREB/ATF bZIP transcription factor antibody
    • Crebzf antibody
    • FLJ94018 antibody
    • HCF-binding transcription factor Zhangfei antibody
    • Host cell factor-binding transcription factor Zhangfei antibody
    • LAZip antibody
    • LAZipII antibody
    • SHP-interacting leucine zipper protein antibody
    • SMILE antibody
    • ZF antibody
    • ZHANG_HUMAN antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized HeLa cells labeling Zhangfei with ab221095 at 4 µg/ml ( green).  

References

ab221095 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221095.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up