Overview

  • Product name

  • Description

    Rabbit polyclonal to ZHX2
  • Host species

    Rabbit
  • Specificity

    It may have slight cross reactivity with ZHX1 and ZHX3 due to 70% sequence similarity.
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human ZHX2 aa 475-505 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    VTGLARSEIKKWFSDHRYRCQRGIVHITSES


    Database link: Q9Y6X8

  • Positive control

    • IHC-P; rat kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab217956 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Rat kidney tissue labeling ZHX2 with ab217956 at 1/100 dilution followed by conjugation to the secondary antibody and DAB staining.

References

ab217956 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217956.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up