Overview

  • Product name

  • Description

    Rabbit polyclonal to ZIC3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human ZIC3 aa 426-467.
    Sequence:

    ESSTPPAIASANSKDTTKTPSAVQTSTSHNPGLPPNFNEWYV


    Database link: O60481

  • Positive control

    • ICC/IF: AF22 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222124 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Acts as transcriptional activator. Required in the earliest stages in both axial midline development and left-right (LR) asymmetry specification. Binds to the minimal GLI-consensus sequence 5'-GGGTGGTC-3'.
  • Involvement in disease

    Heterotaxy, visceral, 1, X-linked
    VACTERL association X-linked with or without hydrocephalus
    Congenital heart defects, multiple types, 1, X-linked
  • Sequence similarities

    Belongs to the GLI C2H2-type zinc-finger protein family.
    Contains 5 C2H2-type zinc fingers.
  • Domain

    The C2H2-type 3, 4 and 5 zinc finger domains are necessary for transcription activation.
  • Cellular localization

    Nucleus. Cytoplasm. Localizes in the cytoplasm in presence of MDFIC overexpression (By similarity). Translocation to the nucleus requires KPNA1 or KPNA6.
  • Information by UniProt
  • Database links

  • Alternative names

    • Heterotaxy 1 antibody
    • HTX antibody
    • HTX1 antibody
    • VACTERLX antibody
    • ZIC 3 antibody
    • Zic family member 3 (odd paired Drosophila homolog heterotaxy 1) antibody
    • Zic family member 3 antibody
    • Zic3 antibody
    • ZIC3_HUMAN antibody
    • Zinc finger protein 203 antibody
    • Zinc finger protein of the cerebellum 3 antibody
    • Zinc finger protein ZIC 3 (Zinc finger protein of the cerebellum 3) antibody
    • Zinc finger protein ZIC 3 antibody
    • ZNF203 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized AF22 cells stained for ZIC3 (green) using ab222124 at 4 µg/ml in ICC/IF.

References

ab222124 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Western blot
Sample
Human Cell lysate - whole cell (Human induced pluripotent cells and placental cell)
Gel Running Conditions
Reduced Denaturing (10 % polyacrylamide)
Loading amount
30 µg
Specification
Human induced pluripotent cells and placental cell
Blocking step
Odyssey Blocking Buffer (Licor) as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 100% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Jun 21 2019

Abreviews
Application
ChIP
Sample
Human Cell lysate - nuclear (Human embryonic stem cells in TESR E8)
Negative control
Two regions of closed chromatin
Specification
Human embryonic stem cells in TESR E8
Detection step
Real-time PCR
Type
Cross-linking (X-ChIP)
Duration of cross-linking step: 10 minute(s) and 0 second(s)
Specification of the cross-linking agent: Paraformaldehyde (1% final con
Positive control
A region on chromosome 8 known to contain open chromatin and Zic motifs

Abcam user community

Verified customer

Submitted Jun 21 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up