Overview

  • Product name

  • Description

    Rabbit polyclonal to ZIC3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human ZIC3 aa 1-240.
    Sequence:

    MTMLLDGGPQFPGLGVGSFGAPRHHEMPNREPAGMGLNPFGDSTHAAAAA AAAAAFKLSPAAAHDLSSGQSSAFTPQGSGYANALGHHHHHHHHHHHTSQ VPSYGGAASAAFNSTREFLFRQRSSGLSEAASGGGQHGLFAGSASSLHAP AGIPEPPSYLLFPGLHEQGAGHPSPTGHVDNNQVHLGLRGELFGRADPYR PVASPRTDPYAAGAQFPNYSPMNMNMGVNVAAHHGPGAFF


    Database link: O60481

  • Positive control

    • IHC-P: Human melanoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab230190 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Acts as transcriptional activator. Required in the earliest stages in both axial midline development and left-right (LR) asymmetry specification. Binds to the minimal GLI-consensus sequence 5'-GGGTGGTC-3'.
  • Involvement in disease

    Heterotaxy, visceral, 1, X-linked
    VACTERL association X-linked with or without hydrocephalus
    Congenital heart defects, multiple types, 1, X-linked
  • Sequence similarities

    Belongs to the GLI C2H2-type zinc-finger protein family.
    Contains 5 C2H2-type zinc fingers.
  • Domain

    The C2H2-type 3, 4 and 5 zinc finger domains are necessary for transcription activation.
  • Cellular localization

    Nucleus. Cytoplasm. Localizes in the cytoplasm in presence of MDFIC overexpression (By similarity). Translocation to the nucleus requires KPNA1 or KPNA6.
  • Information by UniProt
  • Database links

  • Alternative names

    • Heterotaxy 1 antibody
    • HTX antibody
    • HTX1 antibody
    • VACTERLX antibody
    • ZIC 3 antibody
    • Zic family member 3 (odd paired Drosophila homolog heterotaxy 1) antibody
    • Zic family member 3 antibody
    • Zic3 antibody
    • ZIC3_HUMAN antibody
    • Zinc finger protein 203 antibody
    • Zinc finger protein of the cerebellum 3 antibody
    • Zinc finger protein ZIC 3 (Zinc finger protein of the cerebellum 3) antibody
    • Zinc finger protein ZIC 3 antibody
    • ZNF203 antibody
    see all

Images

  • Paraffin-embedded human melanoma tissue stained for ZIC3 with ab230190 at 1/100 dilution in immunohistochemical analysis.

References

ab230190 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230190.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up