Overview

  • Product name

  • Description

    Rabbit polyclonal to ZIC4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ZIC4 aa 7-107.
    Sequence:

    LVMRKRLRLYRNTLKESSSSSGHHGPQLTAASSPSVFPGLHEEPPQASPS RPLNGLLRLGLPGDMYARPEPFPPGPAARSDALAAAAALHGYGGMNLTVN L


    Database link: Q8N9L1

  • Positive control

    • MCF7 cells; Human cerebral cortex tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab204905 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/2500 - 1/5000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Binds to DNA.
  • Sequence similarities

    Belongs to the GLI C2H2-type zinc-finger protein family.
    Contains 5 C2H2-type zinc fingers.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ42609 antibody
    • FLJ45833 antibody
    • Zic family member 4 antibody
    • ZIC4 antibody
    • ZIC4_HUMAN antibody
    • Zinc family member 4 protein HZIC4 antibody
    • Zinc finger protein of cerebellum 4 antibody
    • Zinc finger protein of the cerebellum 4 antibody
    • Zinc finger protein ZIC 4 antibody
    see all

Images

  • Immunofluorescent analysis of MCF7 cells labeling ZIC4 with ab204905 at 4 µg/mL.

  • Immunohistochemical analysis of paraffin-embedded human cerebral cortex tissue labeling ZIC4 with ab204905 at a dilution of 1/2500.

References

ab204905 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204905.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up