Anti-Zika Virus NS1 antibody [F9] - BSA and Azide free (ab218548)
Key features and details
- Mouse monoclonal [F9] to Zika Virus NS1 - BSA and Azide free
- Suitable for: ELISA
- Reacts with: Zika virus
- Isotype: IgG1
Overview
-
Product name
Anti-Zika Virus NS1 antibody [F9] - BSA and Azide free
See all Zika Virus NS1 primary antibodies -
Description
Mouse monoclonal [F9] to Zika Virus NS1 - BSA and Azide free -
Host species
Mouse -
Specificity
This antibody is specific for the NS1 protein of Zika virus, detecting NS1 from both the Uganda and Suriname strains. It demonstrates negligible cross-reactivity with NS1 proteins from Dengue virus (all serotypes), Japanese Encephalitis Virus, West Nile Virus and Yellow Fever Virus -
Tested applications
Suitable for: ELISAmore details
Unsuitable for: WB -
Species reactivity
Reacts with: Zika virus -
Immunogen
Recombinant full length protein corresponding to Zika virus Zika Virus NS1 aa 791-1142. Full length recombinant NS1 (Non Structural protain 1) protein of Zika virus produced in HEK293 cells.
Sequence:DVGCSVDFSKKETRCGTGVFIYNDVEAWRDRYKYHPDSPRRLAAAVKQAW EEGICGISSV SRMENIMWKSVEGELNAILEENGVQLTVVVGSVKNPMW RGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLE HRAWNSFLVEDHGFGVFHTSVWLKVREDYSLECD PAVIGTAVKGREAA HSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGVEESD LI IPKSLAGPLSHHNTREGYRTQVKGPWHSEELEIRFEECPGTKVYVEETCG TRGPSLRS TTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKE PESNLVRSMVTA
Database link: Q32ZE1 -
Positive control
- Direct ELISA - Zika virus NS1 (Uganda and Suriname strains)
-
General notes
For long term storage at +4°C the addition of 0.09% w/v sodium azide is recommended
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Constituent: 100% PBS
Preservative: None present. 0.2 µm filtered. For long term storage at +4°C the addition of 0.09% w/v sodium azide is recommended -
Carrier free
Yes -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from hybridoma cell culture supernatant. >95% pure by SDS-PAGE. -
Clonality
Monoclonal -
Clone number
F9 -
Myeloma
Sp2/0-Ag14 -
Isotype
IgG1
Associated products
-
Compatible Secondaries
-
Conjugation kits
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab218548 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ELISA | Use a concentration of 1 µg/ml. For Direct ELISA, the plate was coated with 100ng of antigen per well, then blocked with 2% BSA and the detection antibody used was Goat anti-mouse IgG HRP conjugated at 1/2000. |
Target
-
Relevance
Zika virus is an emerging disease that is spread by Aedes mosquitoes. The virus was first isolated in Central Africa, and has since spread to South Asia and more recently to South America. It is a member of the flavivirus family, and is structurally closely related to viruses such as Dengue Fever Virus. -
Database links
- Entrez Gene: 7751225 Zika virus
- SwissProt: Q32ZE1 Zika virus
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab218548 has not yet been referenced specifically in any publications.