For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    zika-virus-ns1-antibody-f9-bsa-and-azide-free-ab218548.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Share by email

Anti-Zika Virus NS1 antibody [F9] - BSA and Azide free (ab218548)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Key features and details

  • Mouse monoclonal [F9] to Zika Virus NS1 - BSA and Azide free
  • Suitable for: ELISA
  • Reacts with: Zika virus
  • Isotype: IgG1

You may also be interested in

Secondary
Product image
Goat Anti-Mouse IgG H&L (HRP) (ab205719)
Protein
Recombinant Zika virus NS1 protein (His tag) (ab218550)

View more associated products

Overview

  • Product name

    Anti-Zika Virus NS1 antibody [F9] - BSA and Azide free
    See all Zika Virus NS1 primary antibodies
  • Description

    Mouse monoclonal [F9] to Zika Virus NS1 - BSA and Azide free
  • Host species

    Mouse
  • Specificity

    This antibody is specific for the NS1 protein of Zika virus, detecting NS1 from both the Uganda and Suriname strains. It demonstrates negligible cross-reactivity with NS1 proteins from Dengue virus (all serotypes), Japanese Encephalitis Virus, West Nile Virus and Yellow Fever Virus
  • Tested applications

    Suitable for: ELISAmore details
    Unsuitable for: WB
  • Species reactivity

    Reacts with: Zika virus
  • Immunogen

    Recombinant full length protein corresponding to Zika virus Zika Virus NS1 aa 791-1142. Full length recombinant NS1 (Non Structural protain 1) protein of Zika virus produced in HEK293 cells.
    Sequence:

    DVGCSVDFSKKETRCGTGVFIYNDVEAWRDRYKYHPDSPRRLAAAVKQAW EEGICGISSV SRMENIMWKSVEGELNAILEENGVQLTVVVGSVKNPMW RGPQRLPVPVNELPHGWKAWGK SYFVRAAKTNNSFVVDGDTLKECPLE HRAWNSFLVEDHGFGVFHTSVWLKVREDYSLECD PAVIGTAVKGREAA HSDLGYWIESEKNDTWRLKRAHLIEMKTCEWPKSHTLWTDGVEESD LI IPKSLAGPLSHHNTREGYRTQVKGPWHSEELEIRFEECPGTKVYVEETCG TRGPSLRS TTASGRVIEEWCCRECTMPPLSFRAKDGCWYGMEIRPRKE PESNLVRSMVTA


    Database link: Q32ZE1
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Direct ELISA - Zika virus NS1 (Uganda and Suriname strains)
  • General notes

    For long term storage at +4°C the addition of 0.09% w/v sodium azide is recommended

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7
    Constituent: 100% PBS

    Preservative: None present. 0.2 µm filtered. For long term storage at +4°C the addition of 0.09% w/v sodium azide is recommended
  • Carrier free

    Yes
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from hybridoma cell culture supernatant. >95% pure by SDS-PAGE.
  • Clonality

    Monoclonal
  • Clone number

    F9
  • Myeloma

    Sp2/0-Ag14
  • Isotype

    IgG1

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
  • Conjugation kits

    • Biotinylation Kit / Biotin Conjugation Kit (Fast, Type A) - Lightning-Link® (ab201795)
  • Isotype control

    • Mouse IgG1, kappa monoclonal [15-6E10A7] - Isotype Control (ab170190)
  • Recombinant Protein

    • Recombinant Zika virus NS1 protein (His tag) (ab218550)

Applications

Our Abpromise guarantee covers the use of ab218548 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use a concentration of 1 µg/ml.

For Direct ELISA, the plate was coated with 100ng of antigen per well, then blocked with 2% BSA and the detection antibody used was Goat anti-mouse IgG HRP conjugated at 1/2000.

  • Application notes
    Is unsuitable for WB.
  • Target

    • Relevance

      Zika virus is an emerging disease that is spread by Aedes mosquitoes. The virus was first isolated in Central Africa, and has since spread to South Asia and more recently to South America. It is a member of the flavivirus family, and is structurally closely related to viruses such as Dengue Fever Virus.
    • Database links

      • Entrez Gene: 7751225 Zika virus
      • SwissProt: Q32ZE1 Zika virus

      Protocols

      To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

      Click here to view the general protocols

      Datasheets and documents

      • Datasheet
    • References (0)

      Publishing research using ab218548? Please let us know so that we can cite the reference in this datasheet.

      ab218548 has not yet been referenced specifically in any publications.

      Customer reviews and Q&As

      Show All Reviews Q&A
      Submit a review Submit a question

      There are currently no Customer reviews or Questions for ab218548.
      Please use the links above to contact us or submit feedback about this product.

      Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
      For licensing inquiries, please contact partnerships@abcam.com

      Get resources and offers direct to your inbox Sign up
      A-Z by research area
      • Cancer
      • Cardiovascular
      • Cell biology
      • Developmental biology
      • Epigenetics & Nuclear signaling
      • Immunology
      • Metabolism
      • Microbiology
      • Neuroscience
      • Signal transduction
      • Stem cells
      A-Z by product type
      • Primary antibodies
      • Secondary antibodies
      • Biochemicals
      • Isotype controls
      • Flow cytometry multi-color selector
      • Kits
      • Loading controls
      • Lysates
      • Peptides
      • Proteins
      • Slides
      • Tags and cell markers
      • Tools & Reagents
      Help & support
      • Support
      • Make an Inquiry
      • Protocols & troubleshooting
      • Placing an order
      • RabMAb products
      • Biochemical product FAQs
      • Training
      • Browse by Target
      Company
      • Corporate site
      • Investor relations
      • Company news
      • Careers
      • About us
      • Blog
      Events
      • Tradeshows
      • Conferences
      International websites
      • abcam.cn
      • abcam.co.jp

      Join with us

      • LinkedIn
      • facebook
      • Twitter
      • YouTube
      • Terms of sale
      • Website terms of use
      • Cookie policy
      • Privacy policy
      • Legal
      • Modern slavery statement
      © 1998-2021 Abcam plc. All rights reserved.