Overview

  • Product name

  • Description

    Rabbit polyclonal to ZIP Kinase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Xenopus laevis, Xenopus tropicalis
  • Immunogen

    Recombinant fragment corresponding to Human ZIP Kinase aa 1-172.
    Sequence:

    MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLS SSRRGVSREEIEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGE LFDFLAEKESLTEDEATQFLKQILDGVHYLHSKRIAHFDLKPENIMLLDK NVPNPRIKLIDFGIAHKIEAGN


    Database link: O43293

  • Positive control

    • A549 whole cell lysate, HeLa cells

Properties

Applications

Our Abpromise guarantee covers the use of ab151956 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/3000. Predicted molecular weight: 53 kDa.
ICC/IF 1/100 - 1/1000.

Target

  • Function

    Serine/threonine kinase which acts as a positive regulator of apoptosis. Phosphorylates histone H3 on 'Thr-11' at centromeres during mitosis. Regulates myosin light chain phosphatase through phosphorylation of MYPT1 thereby regulating the assembly of the actin cytoskeleton, cell migration, invasiveness of tumor cells, smooth muscle contraction and neurite outgrowth. Involved in the formation of promyelocytic leukemia protein nuclear body (PML-NB), one of many subnuclear domains in the eukaryotic cell nucleus, and which is involved in oncogenesis and viral infection.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. DAP kinase subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Ubiquitinated. Ubiquitination mediated by the UBE2D3 E3 ligase does not lead to proteasomal degradation, but influences promyelocytic leukemia protein nuclear bodies (PML-NBs) formation in the nucleus.
    Autophosphorylated. Phosphorylated by ROCK1.
  • Cellular localization

    Nucleus. Cytoplasm. Nucleus > PML body. Relocates to the cytoplasm on binding PAWR where the complex appears to interact with actin filaments (By similarity). Localizes to promyelocytic leukemia protein nuclear bodies (PML-NBs). Associates to centromeres from prophase to anaphase.
  • Information by UniProt
  • Database links

  • Alternative names

    • DAP kinase 3 antibody
    • DAP like kinase antibody
    • DAP-like kinase antibody
    • Dapk 3 antibody
    • DAPK3 antibody
    • DAPK3_HUMAN antibody
    • Death associated kinase 3 antibody
    • Death associated protein kinase 3 antibody
    • Death-associated protein kinase 3 antibody
    • Dlk antibody
    • EC 2.7.11.1 antibody
    • FLJ36473 antibody
    • MYPT1 kinase antibody
    • ZIP antibody
    • ZIP kinase antibody
    • ZIP kinase isoform antibody
    • ZIP-kinase antibody
    • ZIPK antibody
    • zipper-interacting protein kinase antibody
    see all

Images

  • Immunofluorescent analysis of 4% paraformaldehyde-fixed (RT for 15 min) HeLa cells labeling ZIP Kinase with ab151956 at 1/500 (green) showing nuclear staining.

    Red: alpha Tubulin, a cytoskeleton marker.

  • Anti-ZIP Kinase antibody (ab151956) at 1/500 dilution + A549 whole cell lysate at 30 µg

    Predicted band size: 53 kDa



    10% SDS PAGE

References

ab151956 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151956.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up