Overview

  • Product name

    Anti-ZMAT5 antibody
  • Description

    Rabbit polyclonal to ZMAT5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human ZMAT5 aa 1-170.
    Sequence:

    MGKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLD EQNKRPCRKFLLTGQCDFGSNCRFSHMSERDLQELSIQVEEERRAREWLL DAPELPEGHLEDWLEKRAKRLSSAPSSRAEPIRTTVFQYPVGWPPVQELP PSLRAPPPGGWPLQPRVQWG


    Database link: Q9UDW3

  • Positive control

    • WB: COLO 320 whole cell lysate. IHC-P: Human tonsil and endometrial cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235355 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000.
IHC-P 1/20 - 1/200.

Target

  • Sequence similarities

    Contains 1 C3H1-type zinc finger.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • U11/U12 small nuclear ribonucleoprotein 20 kDa protein antibody
    • U11/U12 snRNP 20 kDa protein antibody
    • U11/U12 snRNP 20K antibody
    • U11/U12-20K antibody
    • zinc finger matrin type 5 antibody
    • Zinc finger matrin-type protein 5 antibody
    • Zmat5 antibody
    • ZMAT5_HUMAN antibody
    see all

Images

  • Anti-ZMAT5 antibody (ab235355) at 1/500 dilution + COLO 320 (Human colon adenocarcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution
  • Paraffin-embedded human tonsil tissue stained for ZMAT5 using ab235355 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human endometrial cancer tissue stained for ZMAT5 using ab235355 at 1/100 dilution in immunohistochemical analysis.

References

ab235355 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235355.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up