Anti-ZNDR1 antibody (ab254992)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-ZNDR1 antibody -
Description
Rabbit polyclonal to ZNDR1 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Cow, Chimpanzee
-
Immunogen
Recombinant fragment corresponding to Human ZNDR1 aa 65-126.
Sequence:GTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYT CTNCKFQEKEDS
Database link: Q9P1U0 -
Positive control
- IHC-P: Human fallopian tube tissue. ICC/IF: HEK-293 cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab254992 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
| IHC-P | 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors. -
Sequence similarities
Belongs to the archaeal RpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family.
Contains 1 TFIIS-type zinc finger. -
Cellular localization
Nucleus > nucleolus. - Information by UniProt
-
Database links
- Entrez Gene: 471952 Chimpanzee
- Entrez Gene: 535288 Cow
- Entrez Gene: 30834 Human
- Omim: 607525 Human
- SwissProt: Q1XHV8 Chimpanzee
- SwissProt: Q1RMP0 Cow
- SwissProt: Q9P1U0 Human
- Unigene: 57813 Human
-
Alternative names
- DNA directed RNA polymerase I subunit RPA12 antibody
- DNA-directed RNA polymerase I subunit RPA12 antibody
- HTEX 6 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ZNDR1 antibody (ab254992)Paraffin-embedded human fallopian tube tissue stained for ZNDR1 using ab254992 at 1/1000 dilution in immunohistochemical analysis. -
Immunocytochemistry/ Immunofluorescence - Anti-ZNDR1 antibody (ab254992)PFA fixed, Triton X-100 permeabilized HEK293 (Human epithelial cell line from embryonic kidney) cells labeling ZNDR1 using ab254992 at 4µg/ml (green) in ICC/IF.
Datasheets and documents
References
ab254992 has not yet been referenced specifically in any publications.
