Overview

  • Product name

    Anti-ZNF114 antibody [OTI6F4]
  • Description

    Mouse monoclonal [OTI6F4] to ZNF114
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human ZNF114 aa 1-417. Produced in E.coli (NP_705836).
    Sequence:

    MSQDSVTFADVAVNFTKEEWTLLDPAQRNLYRDVMLENSRNLAFIDWATP CKTKDATPQPDILPKRTFPEANRVCLTSISSQHSTLREDWRCPKTEEPHR QGVNNVKPPAVAPEKDESPVSICEDHEMRNHSKPTCRLVPSQGDSIRQCI LTRDSSIFKYNPVLNDSQKTHENNEDDGVLGWNIQWVPCGRKTELKSSTW TGSQNTVHHIRDEIDTGANRHQRNPFGKAFREDGSLRAHNTHGREKMYDF TQCENTSRNNSIHAMQMQLYTAETNKKDCQTGATSANAPNSGSHKSHCTG EKTHKCPECGRAFFYQSFLMRHMKIHTGEKPYECGKCGKAFRYSLHLNKH LRKHVVQKKPYECEECGKVIRESSKYTHIRSHTGEKPYKCKTCGKDFAKS SGLKKHLKTHKDEKPCE


    Database link: Q8NC26

  • Positive control

    • WB: pCMV6-ENTRY ZNF114 cDNA transfected HEK-293T cell lysate.
  • General notes

    Clone OTI6F4 (formerly 6F4).

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    OTI6F4
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236426 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 48 kDa.

Target

  • Function

    May be involved in transcriptional regulation.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 4 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • MGC17986 antibody
    • zinc finger protein 114 (Y18) antibody
    • Zinc finger protein 114 antibody
    • ZN114_HUMAN antibody
    • ZNF114 antibody
    see all

Images

  • All lanes : Anti-ZNF114 antibody [OTI6F4] (ab236426) at 1/2000 dilution

    Lane 1 : pCMV6-ENTRY control cDNA transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : pCMV6-ENTRY ZNF114 cDNA transfected HEK-293T cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 48 kDa

References

ab236426 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236426.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up