Overview

  • Product name

    Anti-ZNF169 antibody
  • Description

    Rabbit polyclonal to ZNF169
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human ZNF169 aa 1-85.
    Sequence:

    MSPGLLTTRKEALMAFRDVAVAFTQKEWKLLSSAQRTLYREVMLENYSHL VSLGIAFSKPKLIEQLEQGDEPWREENEHLLDLCP


    Database link: Q14929

  • Positive control

    • WB: HepG2 and HeLa whole cell lysate. IHC-P: Human colon cancer tissue and small intestine tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab225924 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 68, 45 kDa (predicted molecular weight: 68 kDa).

Target

  • Relevance

    ZNF169 belongs to the krueppel C2H2 type zinc finger protein family. It may be involved in transcriptional regulation. It is highly expressed in kidney, weakly expressed in heart, liver, spleen, and small intestine. Not expressed in adult brain or spinal cord. ZNF169 contains thirteen C2H2 type zinc fingers and one KRAB domain.
  • Cellular localization

    Nucleus
  • Database links

  • Alternative names

    • MGC51961 antibody
    • Zfp169 antibody
    • Zinc finger protein 169 antibody
    • Znf169 antibody

Images

  • All lanes : Anti-ZNF169 antibody (ab225924) at 1/1000 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 3 : Mouse liver tissue lysate
    Lane 4 : Mouse kidney tissue lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/100000 dilution

    Developed using the ECL technique.

    Predicted band size: 68 kDa
    Observed band size: 45,68 kDa
    why is the actual band size different from the predicted?

  • Paraffin embedded human colon cancer tissue stained for ZNF169 with ab225924 (1/100 dilution) in immunohistochemical analysis.

  • Paraffin embedded human small intestine tissue stained for ZNF169 with ab225924 (1/100 dilution) in immunohistochemical analysis.

References

ab225924 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225924.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up