Overview

  • Product name

  • Description

    Rabbit polyclonal to ZNF175
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human ZNF175 aa 1-711.
    Sequence:

    MPADVNLSQKPQVLGPEKQDGSCEASVSFEDVTVDFSREEWQQLDPAQRC LYRDVMLELYSHLFAVGYHIPNPEVIFRMLKEKEPRVEEAEVSHQRCQER EFGLEIPQKEISKKASFQKDMVGEFTRDGSWCSILEELRLDADRTKKDEQ NQIQPMSHSAFFNKKTLNTESNCEYKDPGKMIRTRPHLASSQKQPQKCCL FTESLKLNLEVNGQNESNDTEQLDDVVGSGQLFSHSSSDACSKNIHTGET FCKGNQCRKVCGHKQSLKQHQIHTQKKPDGCSECGGSFTQKSHLFAQQRI HSVGNLHECGKCGKAFMPQLKLSVYLTDHTGDIPCICKECGKVFIQRSEL LTHQKTHTRKKPYKCHDCGKAFFQMLSLFRHQRTHSREKLYECSECGKGF SQNSTLIIHQKIHTGERQYACSECGKAFTQKSTLSLHQRIHSGQKSYVCI ECGQAFIQKAHLIVHQRSHTGEKPYQCHNCGKSFISKSQLDIHHRIHTGE KPYECSDCGKTFTQKSHLNIHQKIHTGERHHVCSECGKAFNQKSILSMHQ RIHTGEKPYKCSECGKAFTSKSQFKEHQRIHTGEKPYVCTECGKAFNGRS NFHKHQITHTRERPFVCYKCGKAFVQKSELITHQRTHMGEKPYECLDCGK SFSKKPQLKVHQRIHTGERPYVCSECGKAFNNRSNFNKHQTTHTRDKSYK CSYSVKGFTKQ


    Database link: Q9Y473

  • Positive control

    • IHC-P: Human adrenal gland tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab238898 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Down-regulates the expression of several chemokine receptors. Interferes with HIV-1 replication by suppressing Tat-induced viral LTR promoter activity.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 15 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • OTK18 antibody
    • Zinc finger protein 175 antibody
    • Zinc finger protein OTK18 antibody
    • ZN175_HUMAN antibody
    • ZNF175 antibody
    see all

Images

  • Paraffin-embedded human adrenal gland tissue stained for ZNF175 using ab238898 at 1/100 dilution in immunohistochemical analysis.

References

ab238898 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238898.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up