Anti-ZNF179/BFP antibody (ab231971)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-ZNF179/BFP antibody
See all ZNF179/BFP primary antibodies -
Description
Rabbit polyclonal to ZNF179/BFP -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Rat
Predicted to work with: Mouse
-
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Rat ZNF179/BFP aa 256-504. Expressed in E.coli.
Sequence:SRETRVKLCALTMMLSSYQILNTSQELKDTDLGYLEMFVHVAEVMGKHYG MVPIQHLDLLVRDSSHHNKSGQGHVGDILQKLSGKYPKVQELLLGKRARC YLLPAPERQWVNKGQASPGGNTEDDFSHHFRAYISDVLSTAPQHAKSRCQ GYWSEGRAMARGDRRLLTGQQLAQEIKNLSGWMGKSGPSFSSPDEMAAQL HDLRKVEAAKKEFEEYVRQQDIATKRIFSALRVLPDTMRNLLSTQKDAI
Database link: O70418 -
Positive control
- IHC-P: Rat intestine, lung and spinal cord tissue. WB: Recombinant rat ZNF179/BFP protein; Rat serum.
-
General notes
This product was previously labelled as ZNF179
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab231971 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | Use a concentration of 5 - 20 µg/ml. | |
| WB | Use a concentration of 0.5 - 5 µg/ml. |
Target
-
Tissue specificity
Predominantly expressed in brain. -
Sequence similarities
Belongs to the TRAFAC class dynamin-like GTPase superfamily. GB1/RHD3-type GTPase family. GB1 subfamily.
Contains 1 GB1/RHD3-type G (guanine nucleotide-binding) domain.
Contains 1 RING-type zinc finger. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 22671 Mouse
- Entrez Gene: 24916 Rat
- SwissProt: Q96DY5 Mouse
- SwissProt: O70418 Rat
- Unigene: 488127 Mouse
- Unigene: 89201 Mouse
- Unigene: 7544 Rat
-
Alternative names
- BFP antibody
- Brain finger protein antibody
- Brain finger protein, murine, human homolog of antibody
see all
Images
-
Western blot - Anti-ZNF179/BFP antibody (ab231971)Anti-ZNF179/BFP antibody (ab231971) at 3 µg/ml + Rat serum
Secondary
HRP-Linked Guinea pig Anti-Rabbit Ab at 1/2000 dilution -
Western blot - Anti-ZNF179/BFP antibody (ab231971)Anti-ZNF179/BFP antibody (ab231971) at 3 µg/ml + Recombinant rat ZNF179/BFP protein
Secondary
HRP-Linked Guinea pig Anti-Rabbit Ab at 1/2000 dilution -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ZNF179/BFP antibody (ab231971)Formalin-fixed, paraffin-embedded rat spinal cord tissue stained for ZNF179/BFP using ab231971 at 10 µg/mL in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ZNF179/BFP antibody (ab231971)Formalin-fixed, paraffin-embedded rat lung tissue stained for ZNF179/BFP using ab231971 at 10 µg/mL in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ZNF179/BFP antibody (ab231971)Formalin-fixed, paraffin-embedded rat intestine tissue stained for ZNF179/BFP using ab231971 at 10 µg/mL in immunohistochemical analysis. DAB staining.
Datasheets and documents
References
ab231971 has not yet been referenced specifically in any publications.
