Anti-ZNF179/BFP antibody (ab231971)
Key features and details
- Rabbit polyclonal to ZNF179/BFP
- Suitable for: IHC-P, WB
- Reacts with: Rat
- Isotype: IgG
Overview
-
Product name
Anti-ZNF179/BFP antibody
See all ZNF179/BFP primary antibodies -
Description
Rabbit polyclonal to ZNF179/BFP -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Rat
Predicted to work with: Mouse -
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Rat ZNF179/BFP aa 256-504. Expressed in E.coli.
Sequence:SRETRVKLCALTMMLSSYQILNTSQELKDTDLGYLEMFVHVAEVMGKHYG MVPIQHLDLLVRDSSHHNKSGQGHVGDILQKLSGKYPKVQELLLGKRARC YLLPAPERQWVNKGQASPGGNTEDDFSHHFRAYISDVLSTAPQHAKSRCQ GYWSEGRAMARGDRRLLTGQQLAQEIKNLSGWMGKSGPSFSSPDEMAAQL HDLRKVEAAKKEFEEYVRQQDIATKRIFSALRVLPDTMRNLLSTQKDAI
Database link: O70418 -
Positive control
- IHC-P: Rat intestine, lung and spinal cord tissue. WB: Recombinant rat ZNF179/BFP protein; Rat serum.
-
General notes
This product was previously labelled as ZNF179
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab231971 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | Use a concentration of 5 - 20 µg/ml. | |
WB | Use a concentration of 0.5 - 5 µg/ml. |
Target
-
Tissue specificity
Predominantly expressed in brain. -
Sequence similarities
Belongs to the TRAFAC class dynamin-like GTPase superfamily. GB1/RHD3-type GTPase family. GB1 subfamily.
Contains 1 GB1/RHD3-type G (guanine nucleotide-binding) domain.
Contains 1 RING-type zinc finger. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 22671 Mouse
- Entrez Gene: 24916 Rat
- SwissProt: Q96DY5 Mouse
- SwissProt: O70418 Rat
- Unigene: 488127 Mouse
- Unigene: 89201 Mouse
- Unigene: 7544 Rat
-
Alternative names
- BFP antibody
- Brain finger protein antibody
- Brain finger protein, murine, human homolog of antibody
see all
Images
-
Anti-ZNF179/BFP antibody (ab231971) at 3 µg/ml + Rat serum
Secondary
HRP-Linked Guinea pig Anti-Rabbit Ab at 1/2000 dilution -
Anti-ZNF179/BFP antibody (ab231971) at 3 µg/ml + Recombinant rat ZNF179/BFP protein
Secondary
HRP-Linked Guinea pig Anti-Rabbit Ab at 1/2000 dilution -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ZNF179/BFP antibody (ab231971)
Formalin-fixed, paraffin-embedded rat spinal cord tissue stained for ZNF179/BFP using ab231971 at 10 µg/mL in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ZNF179/BFP antibody (ab231971)
Formalin-fixed, paraffin-embedded rat lung tissue stained for ZNF179/BFP using ab231971 at 10 µg/mL in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ZNF179/BFP antibody (ab231971)
Formalin-fixed, paraffin-embedded rat intestine tissue stained for ZNF179/BFP using ab231971 at 10 µg/mL in immunohistochemical analysis. DAB staining.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab231971 has not yet been referenced specifically in any publications.