Overview

  • Product name

  • Description

    Rabbit polyclonal to ZNF179/BFP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human ZNF179/BFP aa 73-322. (Expressed in E.coli).
    Sequence:

    GHDFCIRCFSTHRLPGCEPPCCPECRKICKQKRGLRSLGEKMKLLPQRPL PPALQETCPVRAEPLLLVRINASGGLILRMGAINRCLKHPLARDTPVCLL AVLGEQHSGKSFLLNHLLQGLPGLESGEGGRPRGGEASLQGCRWGANGLA RGIWMWSHPFLLGKEGKKVAVFLVDTGDAMSPELSRETRIKLCALTTMLS SYQILSTSQELKDTDLDYLEMFVHVAEVMGKHYGMVPIQHLDLLVRDSSH


    Database link: Q9ULX5

  • Positive control

    • IHC-P: Human prostate, liver and stomach tissues. WB: Human lung lysate; HEK-293T cell lysate; Mouse kidney lysate; Recombinant human ZNF179/BFP protein.
  • General notes

     This product was previously labelled as ZNF179

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    ab233276 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233276 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 68 kDa.

Target

Images

  • Anti-ZNF179/BFP antibody (ab233276) at 3 µg/ml + Human lung lysate

    Secondary
    HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 0.2 µg/ml

    Predicted band size: 68 kDa

  • Paraffin-embedded human prostate tissue stained for ZNF179/BFP using ab233276 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Paraffin-embedded human liver tissue stained for ZNF179/BFP using ab233276 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for ZNF179/BFP using ab233276 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Anti-ZNF179/BFP antibody (ab233276) at 3 µg/ml + HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Secondary
    HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 0.2 µg/ml

    Predicted band size: 68 kDa

  • Anti-ZNF179/BFP antibody (ab233276) at 3 µg/ml + Mouse kidney lysate

    Secondary
    HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 0.2 µg/ml

    Predicted band size: 68 kDa

  • Anti-ZNF179/BFP antibody (ab233276) at 2 µg/ml + Recombinant human ZNF179/BFP protein

    Predicted band size: 68 kDa

References

ab233276 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233276.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up