Anti-ZNF179/BFP antibody (ab233276)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-ZNF179/BFP antibody
See all ZNF179/BFP primary antibodies -
Description
Rabbit polyclonal to ZNF179/BFP -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat -
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Human ZNF179/BFP aa 73-322. (Expressed in E.coli).
Sequence:GHDFCIRCFSTHRLPGCEPPCCPECRKICKQKRGLRSLGEKMKLLPQRPL PPALQETCPVRAEPLLLVRINASGGLILRMGAINRCLKHPLARDTPVCLL AVLGEQHSGKSFLLNHLLQGLPGLESGEGGRPRGGEASLQGCRWGANGLA RGIWMWSHPFLLGKEGKKVAVFLVDTGDAMSPELSRETRIKLCALTTMLS SYQILSTSQELKDTDLDYLEMFVHVAEVMGKHYGMVPIQHLDLLVRDSSH
Database link: Q9ULX5 -
Positive control
- IHC-P: Human prostate, liver and stomach tissues. WB: Human lung lysate; HEK-293T cell lysate; Mouse kidney lysate; Recombinant human ZNF179/BFP protein.
-
General notes
This product was previously labelled as ZNF179
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Protein A purified -
Purification notes
ab233276 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab233276 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | Use a concentration of 5 - 20 µg/ml. | |
WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 68 kDa. |
Target
-
Tissue specificity
Predominantly expressed in brain. -
Sequence similarities
Belongs to the TRAFAC class dynamin-like GTPase superfamily. GB1/RHD3-type GTPase family. GB1 subfamily.
Contains 1 GB1/RHD3-type G (guanine nucleotide-binding) domain.
Contains 1 RING-type zinc finger. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 7732 Human
- Entrez Gene: 22671 Mouse
- Entrez Gene: 24916 Rat
- Omim: 601237 Human
- SwissProt: Q9ULX5 Human
- SwissProt: Q96DY5 Mouse
- SwissProt: O70418 Rat
- Unigene: 189482 Human
see all -
Alternative names
- BFP antibody
- Brain finger protein antibody
- Brain finger protein, murine, human homolog of antibody
see all
Images
-
Anti-ZNF179/BFP antibody (ab233276) at 3 µg/ml + Human lung lysate
Secondary
HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 0.2 µg/ml
Predicted band size: 68 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ZNF179/BFP antibody (ab233276)
Paraffin-embedded human prostate tissue stained for ZNF179/BFP using ab233276 at 10 µg/ml in immunohistochemical analysis.
Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ZNF179/BFP antibody (ab233276)
Paraffin-embedded human liver tissue stained for ZNF179/BFP using ab233276 at 10 µg/ml in immunohistochemical analysis.
Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ZNF179/BFP antibody (ab233276)
Formalin-fixed, paraffin-embedded human stomach tissue stained for ZNF179/BFP using ab233276 at 10 µg/ml in immunohistochemical analysis.
Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.
-
Anti-ZNF179/BFP antibody (ab233276) at 3 µg/ml + HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
Secondary
HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 0.2 µg/ml
Predicted band size: 68 kDa -
Anti-ZNF179/BFP antibody (ab233276) at 3 µg/ml + Mouse kidney lysate
Secondary
HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 0.2 µg/ml
Predicted band size: 68 kDa -
Anti-ZNF179/BFP antibody (ab233276) at 2 µg/ml + Recombinant human ZNF179/BFP protein
Predicted band size: 68 kDa
Datasheets and documents
References
ab233276 has not yet been referenced specifically in any publications.