Overview

  • Product name

  • Description

    Rabbit polyclonal to ZNF179/BFP
  • Host species

    Rabbit
  • Specificity

    This antibody is specific for ZNF179/BFP.

  • Tested applications

    Suitable for: ELISA, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Dog
  • Immunogen

    Synthetic peptide corresponding to Human ZNF179/BFP aa 510-559.
    Sequence:

    GVALLCKGRDQTLEALEAELQATAKAFMDSYTMRFCGHLAAVGGAVGAGL

  • Positive control

    • HepG2 cell lysate
  • General notes

     This product was previously labelled as ZNF179

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab42499 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA 1/62500.
WB Use a concentration of 0.5 µg/ml. Detects a band of approximately 68 kDa (predicted molecular weight: 68 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Images

  • Anti-ZNF179/BFP antibody (ab42499) at 0.5 µg/ml + HepG2 cell lysate

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 68 kDa
    Observed band size: 68 kDa

References

This product has been referenced in:

  • Goonetilleke UR  et al. Death is associated with complement C3 depletion in cerebrospinal fluid of patients with pneumococcal meningitis. MBio 3: (2012). WB ; Human . Read more (PubMed: 22415003) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab42499.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up