Overview

  • Product name
  • Description
    Rabbit polyclonal to ZNF184
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human ZNF184 aa 1-50 (N terminal). The exact sequence is proprietary. NP_009080.2
    Sequence:

    MEDLSSPDSTLLQGGHNLLSSASFQEAVTFKDVIVDFTQEEWKQLDPGQR


    Database link: Q99676

  • Positive control
    • HeLa, Jurkat, 293T whole cell lysates.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7.0-8.0
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab176711 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 86 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Function
    May be involved in transcriptional regulation.
  • Tissue specificity
    Predominant expression in testis.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 19 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Zinc finger protein 184 (Kruppel like) antibody
    • Zinc finger protein 184 antibody
    • ZN184_HUMAN antibody
    • ZNF184 antibody

Images

  • All lanes : Anti-ZNF184 antibody (ab176711) at 0.1 µg/ml

    Lane 1 : Jurkat whole cell lysate at 50 µg
    Lane 2 : Jurkat whole cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 50 µg
    Lane 4 : 293T cell whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 86 kDa


    Exposure time: 30 seconds
  • ZNF184 was immunoprecipitated from 1mg Jurkat whole cell lysate using ab176711 at 6 μg/mg lysate (Lane 1), a rabbit anti-ZNF184 antibobody recognizing a downstream epitope (Lane 2) and control IgG (Lane 3). 20% of Immunoprecipitate was loaded per lane and blotted using ab176711 at 1 μg/ml.

    .

    Detection:

    Chemiluminescence with exposure times of 10 seconds.

References

ab176711 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176711.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up