Overview

  • Product name

    Anti-ZNF2 antibody
  • Description

    Rabbit polyclonal to ZNF2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human ZNF2 aa 134-289.
    Sequence:

    MGTEKQSPSGETRKKSLSRDKGLRRRRSALSREILTKERHQECSDCGKTF FDHSSLTRHQRTHTGEKPYDCRECGKAFSHRSSLSRHLMSHTGESPYECS VCSKAFFDRSSLTVHQRIHTGEKPFQCNECGKAFFDRSSLTRHQRIHTGE SPYECH


    Database link: Q9BSG1

  • Positive control

    • WB: HepG2, HL-60, PC-3 cell lysates; mouse heart and brain lysates. IHC-P: Human pancreatic and endometrial cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab222833 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/5000. Detects a band of approximately 49 kDa (predicted molecular weight: 49 kDa).
IHC-P 1/20 - 1/200.

Target

Images

  • Paraffin-embedded human endometrial cancer tissue stained for ZNF2 using ab222833 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-ZNF2 antibody (ab222833) at 1/2000 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate
    Lane 2 : HL-60 (human promyelocytic leukemia cell line) cell lysate
    Lane 3 : PC-3 (human prostate adenocarcinoma cell line) cell lysate
    Lane 4 : Mouse heart lysate
    Lane 5 : Mouse brain lysate

    Secondary
    All lanes : Goat anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 49 kDa
    Observed band size: 49 kDa

  • Paraffin-embedded human pancreatic cancer tissue stained for ZNF2 using ab222833 at 1/100 dilution in immunohistochemical analysis.

References

ab222833 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222833.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up