Overview

  • Product name

  • Description

    Rabbit polyclonal to ZNF20
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ZNF20 aa 1-200.
    Sequence:

    MMFQDSVAFEDVAVSFTQEEWALLDPSQKNLYRDVMQETFKNLTSVGKTW KVQNIEDEYKNPRRNLSLMREKLCESKESHHCGESFNQIADDMLNRKTLP GITPCESSVCGEVGTGHSSLNTHIRADTGHKSSEYQEYGENPYRNKECKK AFSYLDSFQSHDKACTKEKPYDGKECTETFISHSCIQRHRVMHSGDGPYK


    Database link: P17024

  • Positive control

    • WB: Mouse kidney tissue lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab225929 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 62 kDa (predicted molecular weight: 62 kDa).

Target

  • Function

    May be involved in transcriptional regulation.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 15 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • KOX13 antibody
    • Zinc finger protein 20 antibody
    • Zinc finger protein KOX13 antibody
    • ZNF20 antibody
    • ZNF20_HUMAN antibody
    see all

Images

References

ab225929 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225929.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up