Anti-ZNF212 antibody (ab235438)
Key features and details
- Rabbit polyclonal to ZNF212
- Suitable for: IHC-P, WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-ZNF212 antibody
See all ZNF212 primary antibodies -
Description
Rabbit polyclonal to ZNF212 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant full length protein corresponding to Human ZNF212 aa 1-495.
Sequence:MAESAPARHRRKRRSTPLTSSTLPSQATEKSSYFQTTEISLWTVVAAIQA VEKKMESQAARLQSLEGRTGTAEKKLADCEKMAVEFGNQLEGKWAVLGTL LQEYGLLQRRLENVENLLRNRNFWILRLPPGSKGEAPKVSRSLENDGVCF TEQEWENLEDWQKELYRNVMESNYETLVSLKVLGQTEGEAELGTEMLGDL EEEGPGGAHPAGGVMIKQELQYTQEGPADLPGEFSCIAEEQAFLSPEQTE LWGGQGSSVLLETGPGDSTLEEPVGSRVPSSSRTVGCPKQKSHRQVQLDQ ECGQGLKLKKDTSRPYECSECEITFRYKQQLATHLRSHSGWGSCTPEEPE ESLRPRPRLKPQTKKAKLHQCDVCLRSFSCKVSLVTHQRCHLQEGPSAGQ HVQERFSPNSLVALPGHIPWRKSRSSLICGYCGKSFSHPSDLVRHQRIHT GERPYSCTECEKSFVQKQHLLQHQKIHQRERGGLALEPGRPNGLL
Database link: Q9UDV6 -
Positive control
- WB: Mouse liver lysate. IHC-P: Human lung tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: PBS, 50% Glycerol (glycerin, glycerine), 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab235438 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/20 - 1/200. | |
WB | 1/500 - 1/2000. Predicted molecular weight: 55 kDa. |
Target
-
Function
May be involved in transcriptional regulation. -
Sequence similarities
Belongs to the krueppel C2H2-type zinc-finger protein family.
Contains 4 C2H2-type zinc fingers.
Contains 1 KRAB domain. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 7988 Human
- Entrez Gene: 232784 Mouse
- Omim: 602386 Human
- SwissProt: Q9UDV6 Human
- Unigene: 490510 Human
-
Alternative names
- C2H2 150 antibody
- HGNC13004 antibody
- MGC9707 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ZNF212 antibody (ab235438)
Paraffin-embedded human lung tissue stained for ZNF212 using ab235438 at 1/100 dilution in immunohistochemical analysis.
-
Anti-ZNF212 antibody (ab235438) at 1/500 dilution + Mouse liver lysate
Secondary
Goat polyclonal to rabbit at 1/10000 dilution
Predicted band size: 55 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab235438 has not yet been referenced specifically in any publications.