Overview

  • Product name

  • Description

    Rabbit polyclonal to ZNF232
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human ZNF232 aa 1-417.
    Sequence:

    MAVSLTAAETLALQGTQGQEKMMMMGPKEEEQSCEYETRLPGNHSTSQEI FRQRFRHLRYQETPGPREALSQLRVLCCEWLRPEKHTKEQILEFLVLEQF LTILPEELQSWVRGHHPKSGEEAVTVLEDLEKGLEPEPQVPGPAHGPAQE EPWEKKESLGAAQEALSIQLQPKETQPFPKSEQVYLHFLSVVTEDGPEPK DKGSLPQPPITEVESQVFSEKLATDTSTFEATSEGTLELQQRNPKAERLR WSPAQEESFRQMVVIHKEIPTGKKDHECSECGKTFIYNSHLVVHQRVHSG EKPYKCSDCGKTFKQSSNLGQHQRIHTGEKPFECNECGKAFRWGAHLVQH QRIHSGEKPYECNECGKAFSQSSYLSQHRRIHSGEKPFICKECGKAYGWC SELIRHRRVHARKEPSH


    Database link: Q9UNY5

  • Positive control

    • WB: Mouse heart lysate. IHC-P: Human placenta and breast cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235437 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 48 kDa.
IHC-P 1/20 - 1/200.

Target

  • Function

    May be involved in transcriptional regulation.
  • Tissue specificity

    Ubiquitous. Higher expression seen in the liver, testis and ovary.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 5 C2H2-type zinc fingers.
    Contains 1 SCAN box domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Zinc finger and SCAN domain containing protein 11 antibody
    • Zinc finger and SCAN domain-containing protein 11 antibody
    • Zinc finger protein 232 antibody
    • ZN232_HUMAN antibody
    • ZNF232 antibody
    • ZSCAN11 antibody
    see all

Images

  • Anti-ZNF232 antibody (ab235437) at 1/500 dilution + Mouse heart lysate

    Secondary
    Goat polyclonal to rabbit at 1/10000 dilution

    Predicted band size: 48 kDa

  • Paraffin-embedded human placenta tissue stained for ZNF232 using ab235437 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human breast cancer tissue stained for ZNF232 using ab235437 at 1/100 dilution in immunohistochemical analysis.

References

ab235437 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235437.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up