Overview

  • Product name
  • Description
    Rabbit polyclonal to ZNF24
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Horse, Cow, Dog, Pig, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human ZNF24 aa 100-150. The exact sequence is proprietary. (NP_008896.2).
    Sequence:

    FVAILPKELQTWVRDHHPENGEEAVTVLEDLESELDDPGQPVSLRRRKRE V


    Database link: P17028

  • Positive control
    • HeLa and 293T whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab176589 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 42 kDa.
IP Use at 2-5 µg/mg of lysate.

Target

  • Function
    Transcription factor required for myelination of differentiated oligodendrocytes. Required for the conversion of oligodendrocytes from the premyelinating to the myelinating state. In the developing central nervous system (CNS), involved in the maintenance in the progenitor stage by promoting the cell cycle. Specifically binds to the 5'-TCAT-3' DNA sequence (By similarity). Has transcription repressor activity in vitro.
  • Tissue specificity
    Expressed in many tissues except in heart.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 4 C2H2-type zinc fingers.
    Contains 1 SCAN box domain.
  • Post-translational
    modifications
    Sumoylated.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • KOX17 antibody
    • Retinoic acid suppression protein A antibody
    • RSG A antibody
    • RSG-A antibody
    • RSGA antibody
    • Zfp191 antibody
    • Zinc finger and SCAN domain containing protein 3 antibody
    • Zinc finger and SCAN domain-containing protein 3 antibody
    • Zinc finger protein 191 antibody
    • Zinc finger protein 24 antibody
    • Zinc finger protein KOX17 antibody
    • ZNF 24 antibody
    • ZNF191 antibody
    • ZNF24 antibody
    • ZNF24_HUMAN antibody
    • ZSCAN 3 antibody
    • ZSCAN3 antibody
    see all

Images

  • Detection of ZNF24 by Western Blot of Immunprecipitate.
    ab176589 at 0.4µg/ml labeling ZNF24 in HeLa whole cell lysate (1 mg/IP; 20% of IP loaded) immunoprecipitated using ab176589 at 6µg/mg lysate.

    Detection: Chemiluminescence with exposure time of 3 seconds.

     

  • All lanes : Anti-ZNF24 antibody (ab176589) at 0.04 µg/ml

    Lane 1 : HeLa whole cell lysate at 50 µg
    Lane 2 : HeLa whole cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 5 µg
    Lane 4 : 293T whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 42 kDa


    Exposure time: 3 minutes

References

ab176589 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176589.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up