Overview

  • Product name

  • Description

    Rabbit polyclonal to ZNF24
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Chimpanzee, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human ZNF24 aa 169-368.
    Sequence:

    LDAVENQLKWASWELHSLRHCDDDGRTENGALAPKQELPSALESHEVPGT LNMGVPQIFKYGETCFPKGRFERKRNPSRKKQHICDECGKHFSQGSALIL HQRIHSGEKPYGCVECGKAFSRSSILVQHQRVHTGEKPYKCLECGKAFSQ NSGLINHQRIHTGEKPYECVQCGKSYSQSSNLFRHQRRHNAEKLLNVVKV


    Database link: P17028

  • Positive control

    • WB: HeLa, Jurkat and HEK-293T whole cell lysate. IHC-P: Human breast cancer tissue. Human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab225956 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000.
IHC-P 1/20 - 1/200.

Target

  • Function

    Transcription factor required for myelination of differentiated oligodendrocytes. Required for the conversion of oligodendrocytes from the premyelinating to the myelinating state. In the developing central nervous system (CNS), involved in the maintenance in the progenitor stage by promoting the cell cycle. Specifically binds to the 5'-TCAT-3' DNA sequence (By similarity). Has transcription repressor activity in vitro.
  • Tissue specificity

    Expressed in many tissues except in heart.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 4 C2H2-type zinc fingers.
    Contains 1 SCAN box domain.
  • Post-translational
    modifications

    Sumoylated.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • KOX17 antibody
    • Retinoic acid suppression protein A antibody
    • RSG A antibody
    • RSG-A antibody
    • RSGA antibody
    • Zfp191 antibody
    • Zinc finger and SCAN domain containing protein 3 antibody
    • Zinc finger and SCAN domain-containing protein 3 antibody
    • Zinc finger protein 191 antibody
    • Zinc finger protein 24 antibody
    • Zinc finger protein KOX17 antibody
    • ZNF 24 antibody
    • ZNF191 antibody
    • ZNF24 antibody
    • ZNF24_HUMAN antibody
    • ZSCAN 3 antibody
    • ZSCAN3 antibody
    see all

Images

  • All lanes : Anti-ZNF24 antibody (ab225956) at 1/1000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 2 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 3 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Developed using the ECL technique.
  • Paraffin embedded human kidney tissue stained for ZNF24 with ab225956 (1/100 dilution) in immunohistochemical analysis.

  • Paraffin embedded human breast cancer tissue stained for ZNF24 with ab225956 (1/100 dilution) in immunohistochemical analysis.

References

ab225956 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225956.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up