Overview

  • Product name

    Anti-ZNF300 antibody
  • Description

    Rabbit polyclonal to ZNF300
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human ZNF300 aa 180-230 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    SIQRFHKYDAFKKNLKPNIDLPSCYKSNSRKKPDQSFGGGKSSSQSEPNS N


    Database link: Q96RE9

  • Positive control

    • Rat brain and Mouse intestine tissue lysates; Rat brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab202965 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Use at 1/50 - 1/200 with fluorescent detection methods.

WB 1/100 - 1/1000. Detects a band of approximately 66 kDa (predicted molecular weight: 69 kDa).

Target

  • Function

    Has a transcriptional repressor activity.
  • Tissue specificity

    Expressed mostly in heart, skeletal muscle and brain. Isoform 1 and isoform 2 are highly expressed in testis.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 12 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp686B24204 antibody
    • Kruppel like zinc finger protein antibody
    • OTTHUMP00000160554 antibody
    • OTTHUMP00000206798 antibody
    • Zinc finger protein 300 antibody
    • ZN300_HUMAN antibody
    • ZNF300 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Rat brain tissue labeling ZNF300 with ab202965 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • All lanes : Anti-ZNF300 antibody (ab202965) at 1/200 dilution

    Lane 1 : Rat brain tissue lysate
    Lane 2 : Mouse intestine tissue lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG Antibody (H+L), HRP Conjugated at 1/3000 dilution

    Predicted band size: 69 kDa
    Observed band size: 66 kDa
    why is the actual band size different from the predicted?



    12% Gel.

References

ab202965 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202965.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up