Overview

  • Product name

  • Description

    Rabbit polyclonal to ZNF324
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ZNF324 aa 1-270.
    Sequence:

    MAFEDVAVYFSQEEWGLLDTAQRALYRRVMLDNFALVASLGLSTSRPRVV IQLERGEEPWVPSGTDTTLSRTTYRRRNPGSWSLTEDRDVSGEWPRAFPD TPPGMTTSVFPVAGACHSVKSLQRQRGASPSRERKPTGVSVIYWERLLLG SGSGQASVSLRLTSPLRPPEGVRLREKTLTEHALLGRQPRTPERQKPCAQ EVPGRTFGSAQDLEAAGGRGHHRMGAVWQEPHRLLGGQEPSTWDELGEAL HAGEKSFECRACSKVFVKSS


    Database link: O75467

  • Positive control

    • IHC-P: Human colon cancer and gastric cancer tissues. WB: A549, HEK-293T, MCF7 and Jurkat whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab225914 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 61 kDa (predicted molecular weight: 61 kDa).

Target

  • Function

    May be involved in transcriptional regulation.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 9 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Z324A_HUMAN antibody
    • ZF5128 antibody
    • Zinc finger protein 324A antibody
    • Zinc finger protein ZF5128 antibody
    • ZNF324 antibody
    • ZNF324A antibody
    see all

Images

  • All lanes : Anti-ZNF324 antibody (ab225914) at 1/1000 dilution

    Lane 1 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 3 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 4 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 61 kDa
    Observed band size: 61 kDa

  • Paraffin-embedded human colon cancer tissue stained for ZNF324 using ab225914 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human gastric cancer tissue stained for ZNF324 using ab225914 at 1/100 dilution in immunohistochemical analysis.

References

ab225914 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225914.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up