Overview

  • Product name

  • Description

    Rabbit polyclonal to ZNF331
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human ZNF331 aa 61-131.
    Sequence:

    NIHEIRASKRNSDRRSKSLGRNWICEGTLERPQRSRGRYVNQMIINYVKR PATREGTPPRTHQRHHKENSF


    Database link: Q9NQX6

  • Positive control

    • HEK293 cells

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab221096 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    May be involved in transcriptional regulation. May play a role in spermatogenesis.
  • Tissue specificity

    Testis specific.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 12 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • C2H2 like zinc finger protein antibody
    • C2H2 like zinc finger protein rearranged in thyroid adenomas antibody
    • C2H2-like zinc finger protein rearranged in thyroid adenomas antibody
    • DKFZp686L0787 antibody
    • KRAB zinc finger protein antibody
    • OTTHUMP00000223038 antibody
    • OTTHUMP00000223039 antibody
    • OTTHUMP00000223040 antibody
    • OTTHUMP00000223041 antibody
    • OTTHUMP00000223042 antibody
    • OTTHUMP00000223043 antibody
    • OTTHUMP00000223045 antibody
    • OTTHUMP00000223046 antibody
    • OTTHUMP00000223047 antibody
    • OTTHUMP00000223048 antibody
    • OTTHUMP00000223052 antibody
    • OTTHUMP00000223053 antibody
    • OTTHUMP00000223054 antibody
    • RITA antibody
    • Zinc finger protein 331 antibody
    • Zinc finger protein 361 antibody
    • Zinc finger protein 463 antibody
    • ZN331_HUMAN antibody
    • ZNF331 antibody
    • ZNF361 antibody
    • ZNF463 antibody
    see all

Images

  • Immunofluorescent analysis of paraformaldehyde-fixed, Triton X-100 permeabilized HEK293 cells labeling ZNF331 with ab221096 at 4 μg/ml (green). 

References

ab221096 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221096.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up