Overview

  • Product name

  • Description

    Rabbit polyclonal to ZNF367
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human ZNF367 aa 241-345.
    Sequence:

    RHCPKHPYARLKREEPTDTLSKHQAADNKAAAEWLARYWEMREQRTPTLK GKLVQKADQEQQDPLEYLQSDEEDDEKRGAQRRLQEQRERLHGALALIEL ANLTG


    Database link: Q7RTV3

  • Positive control

    • U-251 MG cells.
  • General notes

     This product was previously labelled as ZNF367, ZNF367

     

Properties

Applications

Our Abpromise guarantee covers the use of ab219957 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

Target

Images

  • Immunofluorescent analysis of PFA fixed, Triton X-100 permeabilized U-251 MG cells labeling ZNF367 with ab219957 at 4 µg/ml (green).

References

ab219957 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219957.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up