Overview

  • Product name
  • Description
    Rabbit polyclonal to ZNF384
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Dog, Pig, Chimpanzee, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human ZNF384 aa 527-577. The exact sequence is proprietary. NP_001129206.1.
    Sequence:

    APQGGGGGDSNPNPPPQCSFDLTPYKTAEHHKDICLTVTTSTIQVEHLAS S


    Database link: Q8TF68

  • Positive control
    • HeLa, 293T and Jurkat lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab176689 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 63 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

Images

  • All lanes : Anti-ZNF384 antibody (ab176689) at 0.04 µg/ml

    Lane 1 : HeLa lysate at 50 µg
    Lane 2 : HeLa lysate at 15 µg
    Lane 3 : 293T lysate at 50 µg
    Lane 4 : Jurkat lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 63 kDa


    Exposure time: 30 seconds
  • Detection of Human ZNF384 by Western Blot of Immunoprecipitates. 1 mg for IP; 20% of IP HeLa whole cell lysate loaded. ab176689 used for IP at 6 µg/mg lysate. For blotting immunoprecipitated ZNF384, ab176689 was used at 0.4 µg/ml.

References

ab176689 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Loading amount
10 µg
Gel Running Conditions
Reduced Denaturing (4-20%)
Sample
Human Cell lysate - whole cell (HEK293)
Specification
HEK293
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C

Abcam user community

Verified customer

Submitted Sep 11 2014

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up