Overview

  • Product name

    Anti-ZNF408 antibody
  • Description

    Rabbit polyclonal to ZNF408
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ZNF408 aa 317-635.
    Sequence:

    PPRAKTPEPGAQQSGFPTLSRSPPGPAGSSPKQGRRYRCGECGKAFLQLC HLKKHAFVHTGHKPFLCTECGKSYSSEESFKAHMLGHRGVRPFPCPQCDK AYGTQRDLKEHQVVHSGARPFACDQCGKAFARRPSLRLHRKTHQVPAAPA PCPCPVCGRPLANQGSLRNHMRLHTGEKPFLCPHCGRAFRQRGNLRGHLR LHTGERPYRCPHCADAFPQLPELRRHLISHTGEAHLCPVCGKALRDPHTL RAHERLHSGERPFPCPQCGRAYTLATKLRRHLKSHLEDKPYRCPTCGMGY TLPQSLRRHQLSHRPEAPC


    Database link: Q9H9D4

  • Positive control

    • IHC-P: Human testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab222803 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    May be involved in transcriptional regulation.
  • Sequence similarities

    Contains 10 C2H2-type zinc fingers.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • EVR6 antibody
    • PFM14 antibody
    • PR domain zinc finger protein 17 antibody
    • PRDM17 antibody
    • RP72 antibody
    • Zinc finger protein 408 antibody
    • ZN408_HUMAN antibody
    • ZNF408 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for ZNF408 using ab222803 at 1/100 dilution in immunohistochemical analysis.

References

ab222803 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222803.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up