Overview

  • Product name

    Anti-ZNF415 antibody
  • Description

    Rabbit polyclonal to ZNF415
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ZNF415 aa 174-289.
    Sequence:

    DRRGIGNKSIKHQLGLSFLPHPHELQQFQAEGKIYECNHVEKSVNHGSSV SPPQIISSTIKTHVSNKYGTDFICSSLLTQEQKSCIREKPYRYIECDKAL NHGSHMTVRQVSHSGE


    Database link: Q09FC8

  • Positive control

    • IHC-P: Human cerebral cortex tissue. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab243381 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Involved in transcriptional regulation. Transcriptional activity differed among the various isoforms. All isoforms except isoform 3 seem to suppresses the transcriptional activities of AP-1 and p53/TP53.
  • Tissue specificity

    Expressed in all tissues examined. Isoforms are differentially expressed. Isoform 3 and isoform 5 were highly expressed, isoform 4 moderately expressed, isoform 2 lower expression, the lowest expression level was seem with isoform 1.
  • Sequence similarities

    Contains 12 C2H2-type zinc fingers.
  • Cellular localization

    Nucleus. Cytoplasm. Isoforms 1, isoform 2, isoform 4 and isoform 5 showed both nuclear and cytoplasm localization. Isoform 3 localized only to nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ11191 antibody
    • Zinc finger protein 415 antibody
    • ZN415_HUMAN antibody
    • ZNF415 antibody
    • ZNF415 zinc finger protein 415 antibody
    see all

Images

  • Immunocytochemistry/Immunofluorescence analysis of U-2 OS (human bone osteosarcoma epithelial cell line) cells labeling ZNF415 using ab243381 at 4 µg/ml (green). Nuclear probe is visualized in blue.

  • Formalin-fixed, paraffin-embedded human cerebral cortex tissue stained for ZNF415 with ab243381 at 1/500 dilution in immunohistochemical analysis.

References

ab243381 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243381.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up