Overview

  • Product name

  • Description

    Rabbit polyclonal to ZNF423
  • Host species

    Rabbit
  • Specificity

    ab216970 may also detect the protein Midasin if used in Human.
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human ZNF423 aa 890-940 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    ICGAAYTMEVLLQNHRLRDHNIRPGEDDGSRKKAEFIKGSHKCNVCSRTF F


    Database link: Q2M1K9

  • Positive control

    • Rat brain tissue.

Applications

Our Abpromise guarantee covers the use of ab216970 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Transcription factor that can both act as an activator or a repressor depending on the context. Plays a central role in BMP signaling and olfactory neurogenesis. Associates with SMADs in response to BMP2 leading to activate transcription of BMP target genes. Acts as a transcriptional repressor via its interaction with EBF1, a transcription factor involved in terminal olfactory receptor neurons differentiation; this interaction preventing EBF1 to bind DNA and activate olfactory-specific genes. Involved in olfactory neurogenesis by participating in a developmental switch that regulates the transition from differentiation to maturation in olfactory receptor neurons. Controls proliferation and differentiation of neural precursors in cerebellar vermis formation.
  • Tissue specificity

    Expressed in brain, lung, skeletal muscle, heart, pancreas and kidney but not liver or placenta. Also expressed in aorta, ovary, pituitary, small intestine, fetal brain, fetal kidney and, within the adult brain, in the substantia nigra, medulla, amygdala, thalamus and cerebellum.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 30 C2H2-type zinc fingers.
  • Domain

    Uses different DNA- and protein-binding zinc fingers to regulate the distinct BMP-Smad and Olf signaling pathways. C2H2-type zinc fingers 14-19 mediate the interaction with SMAD1 and SMAD4, while zinc fingers 28-30 mediate the interaction with EBF1. zinc fingers 2-8 bind the 5'-CCGCCC-3' DNA sequence in concert with EBF1, while zinc fingers 9-13 bind BMP target gene promoters in concert with SMADs.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Early B cell factor associated zinc finger protein antibody
    • Ebfaz antibody
    • hOAZ antibody
    • JBTS19 antibody
    • KIAA0760 antibody
    • NPHP14 antibody
    • Nur12 antibody
    • OAZ antibody
    • OLF 1/EBF associated zinc finger antibody
    • OLF1/EBF associated zinc finger protein antibody
    • Olf1/EBF-associated zinc finger protein antibody
    • Roaz antibody
    • Smad and Olf interacting zinc finger protein antibody
    • Smad- and Olf-interacting zinc finger protein antibody
    • Zfp104 antibody
    • ZFP423 antibody
    • zinc finger protein 423, mouse, homolog of antibody
    • Zinc finger protein 423 antibody
    • ZN423_HUMAN antibody
    • ZNF423 antibody
    • ZNF423 zinc finger protein 423 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling ZNF423 using ab216970 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab216970 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Frozen sections)
Sample
Chicken Tissue sections (adipose progenitor cells)
Permeabilization
No
Specification
adipose progenitor cells
Blocking step
BSA as blocking agent for 30 minute(s) · Concentration: 0.1% · Temperature: 24°C
Fixative
Paraformaldehyde

Arlene .

Verified customer

Submitted Jul 11 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up