Overview

  • Product name

    Anti-ZNF449 antibody [OTI4C6]
  • Description

    Mouse monoclonal [OTI4C6] to ZNF449
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Gorilla
  • Immunogen

    Recombinant full length protein corresponding to Human ZNF449 aa 1-518. (NP_689908) produced in E.coli.
    Sequence:

    MAVALGCAIQASLNQGSVFQEYDTDCEVFRQRFRQFQYREAAGPHEAFNK LWELCCQWLKPKMRSKEQILELLVLEQFLTILPTEIETWVREHCPENRER VVSLIEDLQRELEIPEQQVDMHDMLLEELAPVGTAHIPPTMHLESPALQV MGPAQEAPVAEAWIPQAGPPELNYGATGECQNFLDPGYPLPKLDMNFSLE NREEPWVKELQDSKEMKQLLDSKIGFEIGIENEEDTSKQKKMETMYPFIV TLEGNALQGPILQKDYVQLENQWETPPEDLQTDLAKLVDQQNPTLGETPE NSNLEEPLNPKPHKKKSPGEKPHRCPQCGKCFARKSQLTGHQRIHSGEEP HKCPECGKRFLRSSDLYRHQRLHTGERPYECTVCKKRFTRRSHLIGHQRT HSEEETYKCLECGKSFCHGSSLKRHLKTHTGEKPHRCHNCGKSFSRLTAL TLHQRTHTEERPFKCNYCGKSFRQRPSLVIHLRIHTGEKPYKCTHCSKSF RQRAGLIMHQVTHFRGLI


    Database link: Q6P9G9

  • Positive control

    • WB: pCMV6-ENTRY ZNF449 transfected HEK-293T cell lysate. IHC-P: Human kidney carcinoma, lung carcinoma and bladder tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    OTI4C6
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236427 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 60 kDa.
IHC-P 1/150.

Heat-induced epitope retrieval by Tris-EDTA, pH 8.0.

Target

Images

  • All lanes : Anti-ZNF449 antibody [OTI4C6] (ab236427) at 1/2000 dilution

    Lane 1 : pCMV6-ENTRY control cDNA transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : pCMV6-ENTRY ZNF449 cDNA transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 60 kDa

  • Paraffin-embedded human kidney carcinoma tissue stained for ZNF449 using ab236427 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lung carcinoma tissue stained for ZNF449 using ab236427 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human bladder tissue stained for ZNF449 using ab236427 at 1/150 dilution in immunohistochemical analysis.

References

ab236427 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236427.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up