Overview

  • Product name

    Anti-ZNF502 antibody
  • Description

    Rabbit polyclonal to ZNF502
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ZNF502 aa 6-305.
    Sequence:

    GAEERDIRRETCPGWVNKNKPALEQDVCKIDSSGIVVKRFQEDEYQDSTF EEKYACEGMKENSPREIAESCLFQEGGFGRITFIHKEAPPEIISQGYNFE KSLLLTSSLVTRLRVSTEESLHQWETSNIQTNDISDQSKCPTLCTQKKSW KCNECGKTFTQSSSLTQHQRTHTGERPYTCEECGKAFSRSSFLVQHQRIH TGVKPYGCEQCGKTFRCRSFLTQHQRIHTGEKPYKCNECGNSFRNHSHLT EHQRIHTGEKPYKCNRCGKAFNQNTHLIHHQRIHTGEKPYICSECGSSFR


    Database link: Q8TBZ5

  • Positive control

    • IHC-P: Human prostate cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab239088 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Relevance

    ZNF502 may be involved in transcriptional regulation. It belongs to the krueppel C2H2 type zinc finger protein family. ZNF502 contains fourteen C2H2 type zinc fingers.
  • Cellular localization

    Nucleus
  • Database links

  • Alternative names

    • FLJ12515 antibody
    • FLJ14855 antibody
    • Zinc finger protein 502 antibody

Images

  • Paraffin-embedded human prostate cancer tissue stained for ZNF502 using ab239088 at 1/100 dilution in immunohistochemical analysis.

References

ab239088 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239088.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up