Overview

  • Product name

  • Description

    Rabbit polyclonal to ZNF529
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ZNF529 aa 393-563.
    Sequence:

    PYECKACGKVFRNSSSLTRHQRIHTGEKPYKCKECEKAFGVGSELTRHER IHSGQKPYECKECGKFFRLTSALIQHQRIHSGEKPYECKVCGKAFRHSSA LTEHQRIHTGEKPYECKACGKAFRHSSSFTKHQRIHTDDKPYECKECGNS FSVVGHLTCQPKIYTGEKSFD


    Database link: Q6P280

  • Positive control

    • WB: HeLa and MCF7 whole cell lysates. IHC-P: Human lung cancer and glioma tissues. ICC/IF: A549 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab237486 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 66 kDa.
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

Images

  • A549 (human lung carcinoma cell line) cells stained for ZNF529 (green) using ab237486 at 1/100 dilution in ICC/IF, followed by  Alexa Fluor 488-congugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

  • Paraffin-embedded human glioma tissue stained for ZNF529 using ab237486  at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lung cancer tissue stained for ZNF529 using ab237486  at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-ZNF529 antibody (ab237486) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate.
    Lane 2 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate.

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 66 kDa

References

ab237486 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237486.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up