Overview

  • Product name

    Anti-ZNF544 antibody - N-terminal
  • Description

    Rabbit polyclonal to ZNF544 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ZNF544 aa 1-230 (N terminal).
    Sequence:

    MEARSMLVPPQASVCFEDVAMAFTQEEWEQLDLAQRTLYREVTLETWEHI VSLGLFLSKSDVISQLEQEEDLCRAEQEAPRDWKATLEENRLNSEKDRAR EELSHHVEVYRSGPEEPPSLVLGKVQDQSNQLREHQENSLRFMVLTSERL FAQREHCELELGGGYSLPSTLSLLPTTLPTSTGFPKPNSQVKELKQNSAF INHEKNGADGKHCESHQCARAFCQSIYLSK


    Database link: Q6NX49

  • Positive control

    • IHC-P: Human liver cancer and colon cancer tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224670 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    May be involved in transcriptional regulation.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 13 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Zinc finger protein 544 antibody
    • Zinc finger protein AF020591 antibody
    • ZN544_HUMAN antibody
    • ZNF 544 antibody
    • ZNF544 antibody
    see all

Images

  • Paraffin-embedded human liver cancer tissue stained for ZNF544 using ab224670 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colon cancer tissue stained for ZNF544 using ab224670 at 1/100 dilution in immunohistochemical analysis.

References

ab224670 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224670.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up