Anti-ZNF549 antibody (ab243588)
Key features and details
- Rabbit polyclonal to ZNF549
- Suitable for: ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-ZNF549 antibody
See all ZNF549 primary antibodies -
Description
Rabbit polyclonal to ZNF549 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Orangutan
-
Immunogen
Recombinant fragment corresponding to Human ZNF549 aa 153-229.
Sequence:QDSGEKHIRKEESSALLLNSCKIPLSDNLFPCKDVEKDFPTILGLLQHQT THSRQEYAHRSRETFQQRRYKCEQVFN
Database link: Q6P9A3 -
Positive control
- IHC-P: Human Urinary bladder tissue. ICC/IF: U-2 OS cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab243588 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
| IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Relevance
May be involved in transcriptional regulation. There are two named isoforms. -
Cellular localization
Nuclear -
Database links
- Entrez Gene: 256051 Human
- Entrez Gene: 100172366 Orangutan
- SwissProt: Q6P9A3 Human
- SwissProt: Q5RBQ3 Orangutan
-
Alternative names
- Zinc finger protein 549 antibody
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ZNF549 antibody (ab243588)
Paraffin-embedded human urinary bladder tissue stained for ZNF549 using ab243588 at 1/50 dilution in immunohistochemical analysis.
-
Immunocytochemistry/ Immunofluorescence - Anti-ZNF549 antibody (ab243588)4% paraformaldehyde-fixed, 0.1% Triton X-100 permeabilised U-2 OS (human bone osteosarcoma epithelial cell line) cells labeling ZNF549 (Green) using ab243588 at 4 µg/ml in ICC/IF.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab243588 has not yet been referenced specifically in any publications.
