Overview

  • Product name

    Anti-ZNF558 antibody [OTI2C4]
  • Description

    Mouse monoclonal [OTI2C4] to ZNF558
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human ZNF558 aa 1-402. (NP_653294) produced in E.coli.
    Sequence:

    MAAVILPSTAAPSSLFPASQQKGHTQGGELVNELLTSWLRGLVTFEDVAV EFTQEEWALLDPAQRTLYRDVMLENCRNLASLGCRVNKPSLISQLEQDKK VVTEERGILPSTCPDLETLLKAKWLTPKKNVFRKEQSKGVKTERSHRGVK LNECNQCFKVFSTKSNLTQHKRIHTGEKPYDCSQCGKSFSSRSYLTIHKR IHNGEKPYECNHCGKAFSDPSSLRLHLRIHTGEKPYECNQCFHVFRTSCN LKSHKRIHTGENHHECNQCGKAFSTRSSLTGHNSIHTGEKPYECHDCGKT FRKSSYLTQHVRTHTGEKPYECNECGKSFSSSFSLTVHKRIHTGEKPYEC SDCGKAFNNLSAVKKHLRTHTGEKPYECNHCGKSFTSNSYLSVHKRIHNR WI


    Database link: Q96NG5

  • Positive control

    • IHC-P: Human kidney tissue. WB: pCMV6-ENTRY ZNF558 cDNA transfected HEK-293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab236428 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/150.

Heat-induced epitope retrieval by 1 mM EDTA in 10 mM Tris buffer, pH 8.5 at 120°C for 3 minutes.

WB 1/2000. Predicted molecular weight: 46 kDa.

Target

  • Function

    May be involved in transcriptional regulation.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 9 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ30932 antibody
    • Zinc finger protein 558 antibody
    • ZN558_HUMAN antibody
    • ZNF558 antibody

Images

  • Paraffin-embedded human kidney tissue stained for ZNF558 using ab236428 at 1/150 dilution in immunohistochemical analysis.

  • All lanes : Anti-ZNF558 antibody [OTI2C4] (ab236428) at 1/2000 dilution

    Lane 1 : pCMV6-ENTRY control cDNA transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : pCMV6-ENTRY ZNF558 cDNA transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 46 kDa

References

ab236428 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236428.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up