Overview

  • Product name

    Anti-ZNF589 antibody - C-terminal
    See all ZNF589 primary antibodies
  • Description

    Rabbit polyclonal to ZNF589 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide within Human ZNF589 aa 311-360 (C terminal). The exact sequence is proprietary.
    Sequence:

    SCKPYLIRHQRTHTREKSFMCTVCGRGFREKSELIKHQRIHTGDKPYVCR


    Database link: Q86UQ0-2

  • Positive control

    • Human lung tumor lysates

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab179541 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 41 kDa.

Target

  • Function

    May play a role in hematopoietic stem/progenitor cell differentiation. May play a role as a DNA binding-dependent transcriptional repressor.
  • Tissue specificity

    Isoform 2 is widely expressed. Isoform 3 is only expressed in CD34(+) cells.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 4 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Domain

    The KRAB domain mediates interaction with TRIM28.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • KRAB zinc finger protein SZF1 1 antibody
    • Stem cell zinc finger protein 1 antibody
    • SZF1 antibody
    • Zinc finger protein 589 antibody
    • ZN589_HUMAN antibody
    • ZNF589 antibody
    • ZNP589 antibody
    see all

Images

  • Anti-ZNF589 antibody - C-terminal (ab179541) at 1 µg/ml + Human lung tumor lysates at 10 µg

    Predicted band size: 41 kDa

References

ab179541 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179541.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up