Overview

  • Product name
  • Description
    Rabbit polyclonal to ZNF622
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human ZNF622 aa 125-175. The exact sequence is proprietary. NP_219482.1
    Sequence:

    KDAMNAAIQQAIKAQPSMSPKKAPPAPAKEARNVVAVGTGGRGTHDRDPS E


    Database link: Q969S3

  • Positive control
    • HeLa, 293T and Jurkat whole cell lysates.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7-8
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab174657 was affinity purified using an epitope specific to ZNF622 immobilized on solid support.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab174657 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 54 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Function
    May behave as an activator of the bound transcription factor, MYBL2, and be involved in embryonic development.
  • Tissue specificity
    Expressed in lung, kidney, spleen, liver and brain with lowest expression in kidney.
  • Sequence similarities
    Contains 2 U1-type zinc fingers.
  • Post-translational
    modifications
    Phosphorylated by MELK. The phosphorylation may redirect the protein to the nucleus.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • MGC108936 antibody
    • Zfp622 antibody
    • Zinc finger protein 622 antibody
    • Zinc finger-like protein 9 antibody
    • ZN622_HUMAN antibody
    • ZNF622 antibody
    • ZPR9 antibody
    see all

Images

  • All lanes : Anti-ZNF622 antibody (ab174657) at 0.100000001490116 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 54 kDa


    Exposure time: 10 seconds
  • Detection of ZNF622 by Western Blot of Immunoprecipitate.

References

ab174657 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Loading amount
20 µg
Gel Running Conditions
Reduced Denaturing (4~20%)
Sample
Human Cell lysate - whole cell (293T)
Specification
293T
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C

Abcam user community

Verified customer

Submitted May 30 2014

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up