Anti-ZNF622 antibody (ab174657)
- Datasheet
- References
- Protocols
Overview
-
Product nameAnti-ZNF622 antibody
See all ZNF622 primary antibodies -
DescriptionRabbit polyclonal to ZNF622
-
Host speciesRabbit
-
Tested applicationsSuitable for: WB, IPmore details
-
Species reactivityReacts with: Human
-
Immunogen
Synthetic peptide within Human ZNF622 aa 125-175. The exact sequence is proprietary. NP_219482.1
Sequence:KDAMNAAIQQAIKAQPSMSPKKAPPAPAKEARNVVAVGTGGRGTHDRDPS E
Database link: Q969S3 -
Positive control
- HeLa, 293T and Jurkat whole cell lysates.
Properties
-
FormLiquid
-
Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
-
Storage bufferPreservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7-8 -
Concentration information loading...
-
PurityImmunogen affinity purified
-
Purification notesab174657 was affinity purified using an epitope specific to ZNF622 immobilized on solid support.
-
ClonalityPolyclonal
-
IsotypeIgG
-
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab174657 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/2000 - 1/10000. Predicted molecular weight: 54 kDa. | |
IP | Use at 2-10 µg/mg of lysate. |
Target
-
FunctionMay behave as an activator of the bound transcription factor, MYBL2, and be involved in embryonic development.
-
Tissue specificityExpressed in lung, kidney, spleen, liver and brain with lowest expression in kidney.
-
Sequence similaritiesContains 2 U1-type zinc fingers.
-
Post-translational
modificationsPhosphorylated by MELK. The phosphorylation may redirect the protein to the nucleus. -
Cellular localizationCytoplasm. Nucleus.
- Information by UniProt
-
Database links
- Entrez Gene: 90441 Human
- Omim: 608694 Human
- SwissProt: Q969S3 Human
- Unigene: 60300 Human
-
Alternative names
- MGC108936 antibody
- Zfp622 antibody
- Zinc finger protein 622 antibody
see all
Images
-
All lanes : Anti-ZNF622 antibody (ab174657) at 0.100000001490116 µg/ml
Lane 1 : HeLa whole cell lysate
Lane 2 : 293T whole cell lysate
Lane 3 : Jurkat whole cell lysate
Lysates/proteins at 50 µg per lane.
Developed using the ECL technique.
Predicted band size: 54 kDa
Exposure time: 10 seconds -
Detection of ZNF622 by Western Blot of Immunoprecipitate.
Datasheets and documents
References
ab174657 has not yet been referenced specifically in any publications.