Overview

  • Product name

    Anti-ZNF645 antibody
  • Description

    Rabbit polyclonal to ZNF645
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human ZNF645 aa 200-413.
    Sequence:

    QHNQPHKDIQAPPPELSLSLPFPIQWETVSIFTRKHGNLTVDHIQNNSDS GAKKPTPPDYYPECQSQPAVSSPHHIIPQKQHYAPPPSPSSPVNHQMPYP PQDVVTPNSVRSQVPALTTTYDPSSGYIIVKVPPDMNSPPLRAPQSQNGN PSASEFASHHYNLNILPQFTENQETLSPQFTQTDAMDHRRWPAWKRLSPC PPTRSPPPSTLHGR


    Database link: Q8N7E2

  • Positive control

    • WB: Jurkat and MCF7 whole cell lysate. Mouse heart and brain tissue lysate. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224745 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
WB 1/500 - 1/5000.

Target

  • Relevance

    ZNF645 contains 1 RING-type zinc finger, which is probably involved in mediating protein-protein interactions.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • FLJ25735 antibody
    • HAKAIL antibody
    • Zinc finger protein 645 antibody

Images

  • All lanes : Anti-ZNF645 antibody (ab224745) at 1/500 dilution

    Lane 1 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 2 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 3 : Mouse heart tissue lysate
    Lane 4 : Mouse brain tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG

    Developed using the ECL technique.
  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for ZNF645 (green) using ab224745 (1/100 dilution) in ICC/IF. Secondary: Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab224745 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224745.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up