Overview

  • Product name

  • Description

    Rabbit polyclonal to ZNF662
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ZNF662 aa 120-190.
    Sequence:

    SQELWFGKTCEEKSRLGRWPGYLNGGRMESSTNDIIEVIVKDEMISVEES SGNTDVNNLLGIHHKILNEQI


    Database link: Q6ZS27

  • Positive control

    • IHC-P: Human testis tissue. WB: RT4 and U-251 MG cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab243540 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.4 µg/ml.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May be involved in transcriptional regulation.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 8 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Form

    There are 2 isoforms produced by alternative splicing.
  • Alternative names

    • FLJ33347 antibody
    • FLJ45880 antibody
    • MGC149141 antibody
    • Zinc finger protein 662 antibody
    • ZN662_HUMAN antibody
    • ZNF662 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human testis tissue stained for ZNF662 with ab243540 at a 1/200 dilution in immunohistochemical analysis.

  • All lanes : Anti-ZNF662 antibody (ab243540) at 0.4 µg/ml

    Lane 1 : RT4 (Human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (Human brain glioma cell line) cell lysate

References

ab243540 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243540.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up