Overview

  • Product name

    Anti-ZNF674 antibody
  • Description

    Rabbit polyclonal to ZNF674
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ZNF674 aa 89-121. ENSEMBL: ENSG00000251192
    Sequence:

    VDEQIDHYKESQDKLPWQAAFIGKETLKDESGQ


    Database link: Q2M3X9

  • Positive control

    • U-2 OS cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab221463 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    May be involved in transcriptional regulation.
  • Tissue specificity

    Expressed in testis.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 11 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Developmental stage

    Expressed in fetal brain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • MENTAL RETARDATION, X LINKED 92 antibody
    • MRX92 antibody
    • Zinc finger family member 674 antibody
    • Zinc finger protein 674 antibody
    • ZN674_HUMAN antibody
    • ZNF673B antibody
    • ZNF674 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2 OS cells labeling ZNF674 with ab221463 at 4 µg/ml.  Antibody staining is shown in green.  

References

ab221463 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221463.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up